path: root/include
diff options
authorAlex Heck <>2007-03-17 19:55:09 -0400
committerAlex Heck <>2007-03-17 19:55:09 -0400
commit3c464a6f450c7b9e5f35460458e4d37a9be15f6e (patch)
treec98caeee9b16d98fee3db95977a713b25bb7919b /include
parentd34c1c65bd18eaaae2d1da2a32654916477cb86f (diff)
Added missing filesHEADmaster
Diffstat (limited to 'include')
35 files changed, 18300 insertions, 0 deletions
diff --git a/include/GL/ b/include/GL/
new file mode 100644
index 0000000..f6ee21a
--- /dev/null
+++ b/include/GL/
@@ -0,0 +1,44 @@
+## Process this file with automake to produce
+## Process this file with automake to produce
+GLincludedir = $(includedir)/GL
+INC_FX = fxmesa.h
+INC_GGI = ggimesa.h
+INC_OSMESA = osmesa.h
+INC_SVGA = svgamesa.h
+INC_X11 = glx.h glxext.h glx_mangle.h xmesa.h xmesa_x.h xmesa_xf86.h
+INC_GLUT = glut.h glutf90.h
+sel_inc_fx = $(INC_FX)
+sel_inc_ggi = $(INC_GGI)
+sel_inc_osmesa = $(INC_OSMESA)
+sel_inc_svga = $(INC_SVGA)
+if HAVE_X11
+sel_inc_x11 = $(INC_X11)
+sel_inc_glut = $(INC_GLUT)
+EXTRA_HEADERS = amesa.h dosmesa.h foomesa.h glut_h.dja mesa_wgl.h mglmesa.h \
+ vms_x_fix.h wmesa.h \
+GLinclude_HEADERS = gl.h glext.h gl_mangle.h glu.h glu_mangle.h \
+ $(sel_inc_fx) $(sel_inc_ggi) $(sel_inc_osmesa) $(sel_inc_svga) \
+ $(sel_inc_x11) $(sel_inc_glut)
+include $(top_srcdir)/common_rules.make
diff --git a/include/GL/amesa.h b/include/GL/amesa.h
new file mode 100644
index 0000000..852d34c
--- /dev/null
+++ b/include/GL/amesa.h
@@ -0,0 +1,65 @@
+ * Mesa 3-D graphics library
+ * Version: 3.3
+ *
+ * Copyright (C) 1999-2000 Brian Paul All Rights Reserved.
+ *
+ * Permission is hereby granted, free of charge, to any person obtaining a
+ * copy of this software and associated documentation files (the "Software"),
+ * to deal in the Software without restriction, including without limitation
+ * the rights to use, copy, modify, merge, publish, distribute, sublicense,
+ * and/or sell copies of the Software, and to permit persons to whom the
+ * Software is furnished to do so, subject to the following conditions:
+ *
+ * The above copyright notice and this permission notice shall be included
+ * in all copies or substantial portions of the Software.
+ *
+ */
+/* Allegro (DJGPP) driver by Bernhard Tschirren ( */
+#ifndef AMESA_H
+#define AMESA_H
+typedef struct amesa_visual *AMesaVisual;
+typedef struct amesa_buffer *AMesaBuffer;
+typedef struct amesa_context *AMesaContext;
+extern AMesaVisual AMesaCreateVisual(GLboolean dbFlag, GLint depth,
+ GLint depthSize,
+ GLint stencilSize,
+ GLint accumSize);
+extern void AMesaDestroyVisual(AMesaVisual visual);
+extern AMesaBuffer AMesaCreateBuffer(AMesaVisual visual,
+ GLint width, GLint height);
+extern void AMesaDestroyBuffer(AMesaBuffer buffer);
+extern AMesaContext AMesaCreateContext(AMesaVisual visual,
+ AMesaContext sharelist);
+extern void AMesaDestroyContext(AMesaContext context);
+extern GLboolean AMesaMakeCurrent(AMesaContext context, AMesaBuffer buffer);
+extern void AMesaSwapBuffers(AMesaBuffer buffer);
+#endif /* AMESA_H */
diff --git a/include/GL/directfbgl.h b/include/GL/directfbgl.h
new file mode 100644
index 0000000..984c4b1
--- /dev/null
+++ b/include/GL/directfbgl.h
@@ -0,0 +1,89 @@
+ (c) Copyright 2001 convergence integrated media GmbH.
+ All rights reserved.
+ Written by Denis Oliver Kropp <> and
+ Andreas Hundt <>.
+ This library is free software; you can redistribute it and/or
+ modify it under the terms of the GNU Lesser General Public
+ License as published by the Free Software Foundation; either
+ version 2 of the License, or (at your option) any later version.
+ This library is distributed in the hope that it will be useful,
+ but WITHOUT ANY WARRANTY; without even the implied warranty of
+ Lesser General Public License for more details.
+ You should have received a copy of the GNU Lesser General Public
+ License along with this library; if not, write to the
+ Free Software Foundation, Inc., 59 Temple Place - Suite 330,
+ Boston, MA 02111-1307, USA.
+#ifndef __DIRECTFBGL_H__
+#define __DIRECTFBGL_H__
+#include <directfb.h>
+#ifdef __cplusplus
+extern "C"
+typedef struct {
+ int buffer_size;
+ int depth_size;
+ int stencil_size;
+ int aux_buffers;
+ int red_size;
+ int green_size;
+ int blue_size;
+ int alpha_size;
+ int accum_red_size;
+ int accum_green_size;
+ int accum_blue_size;
+ int accum_alpha_size;
+ DFBBoolean double_buffer;
+ DFBBoolean stereo;
+} DFBGLAttributes;
+ /** Context handling **/
+ /*
+ * Acquire the hardware lock.
+ */
+ DFBResult (*Lock) (
+ IDirectFBGL *thiz
+ );
+ /*
+ * Release the lock.
+ */
+ DFBResult (*Unlock) (
+ IDirectFBGL *thiz
+ );
+ /*
+ * Query the OpenGL attributes.
+ */
+ DFBResult (*GetAttributes) (
+ IDirectFBGL *thiz,
+ DFBGLAttributes *attributes
+ );
+#ifdef __cplusplus
diff --git a/include/GL/dmesa.h b/include/GL/dmesa.h
new file mode 100644
index 0000000..358082e
--- /dev/null
+++ b/include/GL/dmesa.h
@@ -0,0 +1,160 @@
+ * Mesa 3-D graphics library
+ * Version: 6.1
+ *
+ * Copyright (C) 1999-2004 Brian Paul All Rights Reserved.
+ *
+ * Permission is hereby granted, free of charge, to any person obtaining a
+ * copy of this software and associated documentation files (the "Software"),
+ * to deal in the Software without restriction, including without limitation
+ * the rights to use, copy, modify, merge, publish, distribute, sublicense,
+ * and/or sell copies of the Software, and to permit persons to whom the
+ * Software is furnished to do so, subject to the following conditions:
+ *
+ * The above copyright notice and this permission notice shall be included
+ * in all copies or substantial portions of the Software.
+ *
+ */
+ * DOS/DJGPP device driver for Mesa
+ *
+ * Author: Daniel Borca
+ * Email :
+ * Web :
+ */
+#ifndef DMESA_H_included
+#define DMESA_H_included
+/* Sample Usage:
+ *
+ * 1. Call DMesaCreateVisual() to initialize graphics.
+ * 2. Call DMesaCreateContext() to create a DMesa rendering context.
+ * 3. Call DMesaCreateBuffer() to define the window.
+ * 4. Call DMesaMakeCurrent() to bind the DMesaBuffer to a DMesaContext.
+ * 5. Make gl* calls to render your graphics.
+ * 6. Use DMesaSwapBuffers() when double buffering to swap front/back buffers.
+ * 7. Before exiting, destroy DMesaBuffer, DMesaContext and DMesaVisual.
+ */
+typedef struct dmesa_context *DMesaContext;
+typedef struct dmesa_visual *DMesaVisual;
+typedef struct dmesa_buffer *DMesaBuffer;
+#ifdef __cplusplus
+extern "C" {
+ * Create a new Visual and set graphics mode.
+ */
+DMesaVisual DMesaCreateVisual (GLint width, /* X res */
+ GLint height, /* Y res */
+ GLint colDepth, /* BPP */
+ GLint refresh, /* refresh rate: 0=default */
+ GLboolean dbFlag, /* double-buffered */
+ GLboolean rgbFlag, /* RGB mode */
+ GLint alphaSize, /* requested bits/alpha */
+ GLint depthSize, /* requested bits/depth */
+ GLint stencilSize, /* requested bits/stencil */
+ GLint accumSize); /* requested bits/accum */
+ * Destroy Visual and restore screen.
+ */
+void DMesaDestroyVisual (DMesaVisual v);
+ * Create a new Context for rendering.
+ */
+DMesaContext DMesaCreateContext (DMesaVisual visual, DMesaContext share);
+ * Destroy Context.
+ */
+void DMesaDestroyContext (DMesaContext c);
+ * Return a handle to the current context.
+ */
+DMesaContext DMesaGetCurrentContext (void);
+ * Create a new Buffer (window).
+ */
+DMesaBuffer DMesaCreateBuffer (DMesaVisual visual,
+ GLint xpos, GLint ypos,
+ GLint width, GLint height);
+ * Destroy Buffer.
+ */
+void DMesaDestroyBuffer (DMesaBuffer b);
+ * Return a handle to the current buffer.
+ */
+DMesaBuffer DMesaGetCurrentBuffer (void);
+ * Swap the front and back buffers for the given Buffer.
+ * No action is taken if the buffer is not double buffered.
+ */
+void DMesaSwapBuffers (DMesaBuffer b);
+ * Bind Buffer to Context and make the Context the current one.
+ */
+GLboolean DMesaMakeCurrent (DMesaContext c, DMesaBuffer b);
+ * Move/Resize current Buffer.
+ */
+GLboolean DMesaMoveBuffer (GLint xpos, GLint ypos);
+GLboolean DMesaResizeBuffer (GLint width, GLint height);
+ * Set palette index, using normalized values.
+ */
+void DMesaSetCI (int ndx, GLfloat red, GLfloat green, GLfloat blue);
+ * DMesa functions
+ */
+typedef void (*DMesaProc) ();
+DMesaProc DMesaGetProcAddress (const char *name);
+ * DMesa state retrieval.
+ */
+#define DMESA_GET_SCREEN_SIZE 0x0100
+#define DMESA_GET_DRIVER_CAPS 0x0200
+#define DMESA_GET_VIDEO_MODES 0x0300
+#define DMESA_GET_BUFFER_ADDR 0x0400
+#define DMESA_DRIVER_DBL_BIT 0x1 /* double-buffered */
+#define DMESA_DRIVER_YUP_BIT 0x2 /* lower-left window origin */
+int DMesaGetIntegerv (GLenum pname, GLint *params);
+#ifdef __cplusplus
diff --git a/include/GL/foomesa.h b/include/GL/foomesa.h
new file mode 100644
index 0000000..8517d88
--- /dev/null
+++ b/include/GL/foomesa.h
@@ -0,0 +1,76 @@
+ * Mesa 3-D graphics library
+ * Version: 3.0
+ * Copyright (C) 1995-1998 Brian Paul
+ *
+ * This library is free software; you can redistribute it and/or
+ * modify it under the terms of the GNU Library General Public
+ * License as published by the Free Software Foundation; either
+ * version 2 of the License, or (at your option) any later version.
+ *
+ * This library is distributed in the hope that it will be useful,
+ * but WITHOUT ANY WARRANTY; without even the implied warranty of
+ * Library General Public License for more details.
+ *
+ * You should have received a copy of the GNU Library General Public
+ * License along with this library; if not, write to the Free
+ * Software Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA.
+ */
+ * Example Foo/Mesa interface. See src/ddsample.c for more info.
+ */
+#ifndef FOOMESA_H
+#define FOOMESA_H
+typedef struct foo_mesa_visual *FooMesaVisual;
+typedef struct foo_mesa_buffer *FooMesaBuffer;
+typedef struct foo_mesa_context *FooMesaContext;
+#ifdef BEOS
+#pragma export on
+extern FooMesaVisual FooMesaChooseVisual( /* your params */ );
+extern void FooMesaDestroyVisual( FooMesaVisual visual );
+extern FooMesaBuffer FooMesaCreateBuffer( FooMesaVisual visual,
+ void *your_window_id );
+extern void FooMesaDestroyBuffer( FooMesaBuffer buffer );
+extern FooMesaContext FooMesaCreateContext( FooMesaVisual visual,
+ FooMesaContext sharelist );
+extern void FooMesaDestroyContext( FooMesaContext context );
+extern void FooMesaMakeCurrent( FooMesaContext context, FooMesaBuffer buffer );
+extern void FooMesaSwapBuffers( FooMesaBuffer buffer );
+/* Probably some more functions... */
+#ifdef BEOS
+#pragma export off
diff --git a/include/GL/fxmesa.h b/include/GL/fxmesa.h
new file mode 100644
index 0000000..f8e9661
--- /dev/null
+++ b/include/GL/fxmesa.h
@@ -0,0 +1,103 @@
+ * Mesa 3-D graphics library
+ * Version: 4.0
+ * Copyright (C) 1995-2001 Brian Paul
+ *
+ * This library is free software; you can redistribute it and/or
+ * modify it under the terms of the GNU Library General Public
+ * License as published by the Free Software Foundation; either
+ * version 2 of the License, or (at your option) any later version.
+ *
+ * This library is distributed in the hope that it will be useful,
+ * but WITHOUT ANY WARRANTY; without even the implied warranty of
+ * Library General Public License for more details.
+ *
+ * You should have received a copy of the GNU Library General Public
+ * License along with this library; if not, write to the Free
+ * Software Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA.
+ */
+ * FXMesa - 3Dfx Glide driver for Mesa. Contributed by David Bucciarelli
+ *
+ * NOTE: This version requires Glide3 (
+ */
+#ifndef FXMESA_H
+#define FXMESA_H
+#include <glide.h>
+#ifdef __cplusplus
+extern "C" {
+ * Values for attribList parameter to fxMesaCreateContext():
+ */
+#define FXMESA_NONE 0 /* to terminate attribList */
+#define FXMESA_ALPHA_SIZE 11 /* followed by an integer */
+#define FXMESA_DEPTH_SIZE 12 /* followed by an integer */
+#define FXMESA_STENCIL_SIZE 13 /* followed by an integer */
+#define FXMESA_ACCUM_SIZE 14 /* followed by an integer */
+#define FXMESA_COLORDEPTH 20 /* followed by an integer */
+#define FXMESA_SHARE_CONTEXT 990099 /* keep in sync with xmesa1.c! */
+typedef struct tfxMesaContext *fxMesaContext;
+#if defined (__BEOS__)
+#pragma export on
+GLAPI fxMesaContext GLAPIENTRY fxMesaCreateContext(GLuint win, GrScreenResolution_t,
+ GrScreenRefresh_t,
+ const GLint attribList[]);
+GLAPI fxMesaContext GLAPIENTRY fxMesaCreateBestContext(GLuint win,
+ GLint width, GLint height,
+ const GLint attribList[]);
+GLAPI void GLAPIENTRY fxMesaDestroyContext(fxMesaContext ctx);
+GLAPI GLint GLAPIENTRY fxMesaSelectCurrentBoard(int n);
+GLAPI void GLAPIENTRY fxMesaMakeCurrent(fxMesaContext ctx);
+GLAPI fxMesaContext GLAPIENTRY fxMesaGetCurrentContext(void);
+GLAPI void GLAPIENTRY fxMesaSwapBuffers(void);
+GLAPI void GLAPIENTRY fxMesaSetNearFar(GLfloat nearVal, GLfloat farVal);
+GLAPI void GLAPIENTRY fxMesaUpdateScreenSize(fxMesaContext ctx);
+GLAPI void GLAPIENTRY fxCloseHardware(void);
+GLAPI void GLAPIENTRY fxGetScreenGeometry (GLint *w, GLint *h);
+#if defined (__BEOS__)
+#pragma export off
+#ifdef __cplusplus
diff --git a/include/GL/ggimesa.h b/include/GL/ggimesa.h
new file mode 100644
index 0000000..90e0b42
--- /dev/null
+++ b/include/GL/ggimesa.h
@@ -0,0 +1,85 @@
+ * Mesa 3-D graphics library GGI bindings (GGIGL [giggle])
+ * Version: 4.0
+ * Copyright (C) 1995-2000 Brian Paul
+ * Copyright (C) 1998 Uwe Maurer
+ * Copyrigth (C) 2001 Filip Spacek
+ *
+ * This library is free software; you can redistribute it and/or
+ * modify it under the terms of the GNU Library General Public
+ * License as published by the Free Software Foundation; either
+ * version 2 of the License, or (at your option) any later version.
+ *
+ * This library is distributed in the hope that it will be useful,
+ * but WITHOUT ANY WARRANTY; without even the implied warranty of
+ * Library General Public License for more details.
+ *
+ * You should have received a copy of the GNU Library General Public
+ * License along with this library; if not, write to the Free
+ * Software Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA.
+ */
+#ifndef GGIMESA_H
+#define GGIMESA_H
+#ifdef __cplusplus
+extern "C" {
+#include <ggi/ggi.h>
+#include "GL/gl.h"
+typedef struct ggi_mesa_context *ggi_mesa_context_t;
+ * Initialize Mesa GGI extension
+ */
+int ggiMesaInit(void);
+ * Clean up Mesa GGI exension
+ */
+int ggiMesaExit(void);
+ * Attach Mesa GGI extension to the visual 'vis'
+ */
+int ggiMesaAttach(ggi_visual_t vis);
+ * Detach Mesa GGI extension from the visual 'vis'
+ */
+int ggiMesaDetach(ggi_visual_t vis);
+int ggiMesaExtendVisual(ggi_visual_t vis, GLboolean alpha_flag,
+ GLboolean stereo_flag, GLint depth_size,
+ GLint stencil_size, GLint accum_red_size,
+ GLint accum_green_size, GLint accum_blue_size,
+ GLint accum_alpha_size, GLint num_samples);
+ * Create a new context capable of displaying on the visual vis.
+ */
+ggi_mesa_context_t ggiMesaCreateContext(ggi_visual_t vis);
+ * Destroy the context 'ctx'
+ */
+void ggiMesaDestroyContext(ggi_mesa_context_t ctx);
+ * Make context 'ctx' the current context and bind it to visual 'vis'.
+ * Note that the context must have been created with respect to that visual.
+ */
+void ggiMesaMakeCurrent(ggi_mesa_context_t ctx, ggi_visual_t vis);
+void ggiMesaSwapBuffers(void);
+#ifdef __cplusplus
diff --git a/include/GL/gl.h b/include/GL/gl.h
new file mode 100644
index 0000000..40f3b9d
--- /dev/null
+++ b/include/GL/gl.h
@@ -0,0 +1,2383 @@
+ * Mesa 3-D graphics library
+ * Version: 6.5.1
+ *
+ * Copyright (C) 1999-2006 Brian Paul All Rights Reserved.
+ *
+ * Permission is hereby granted, free of charge, to any person obtaining a
+ * copy of this software and associated documentation files (the "Software"),
+ * to deal in the Software without restriction, including without limitation
+ * the rights to use, copy, modify, merge, publish, distribute, sublicense,
+ * and/or sell copies of the Software, and to permit persons to whom the
+ * Software is furnished to do so, subject to the following conditions:
+ *
+ * The above copyright notice and this permission notice shall be included
+ * in all copies or substantial portions of the Software.
+ *
+ */
+#ifndef __gl_h_
+#define __gl_h_
+#if defined(USE_MGL_NAMESPACE)
+#include "gl_mangle.h"
+ * Begin system-specific stuff. Do not do any of this when building
+ * for SciTech SNAP, as this is all done before this header file is
+ * included.
+ */
+#if !defined(__SCITECH_SNAP__)
+#if defined(__BEOS__)
+#include <stdlib.h> /* to get some BeOS-isms */
+#if !defined(OPENSTEP) && (defined(NeXT) || defined(NeXT_PDO))
+#define OPENSTEP
+#if defined(_WIN32) && !defined(__WIN32__) && !defined(__CYGWIN__)
+#define __WIN32__
+#if !defined(OPENSTEP) && (defined(__WIN32__) && !defined(__CYGWIN__))
+# if (defined(_MSC_VER) || defined(__MINGW32__)) && defined(BUILD_GL32) /* tag specify we're building mesa as a DLL */
+# define GLAPI __declspec(dllexport)
+# elif (defined(_MSC_VER) || defined(__MINGW32__)) && defined(_DLL) /* tag specifying we're building for DLL runtime support */
+# define GLAPI __declspec(dllimport)
+# else /* for use with static link lib build of Win32 edition only */
+# define GLAPI extern
+# endif /* _STATIC_MESA support */
+# define GLAPIENTRY __stdcall
+#elif defined(__CYGWIN__) && defined(USE_OPENGL32) /* use native windows opengl32 */
+# define GLAPI extern
+# define GLAPIENTRY __stdcall
+#elif defined(__GNUC__) && (__GNUC__ * 100 + __GNUC_MINOR__) >= 303
+# define GLAPI __attribute__((visibility("default")))
+# define GLAPIENTRY
+#endif /* WIN32 && !CYGWIN */
+#if (defined(__BEOS__) && defined(__POWERPC__)) || defined(__QUICKDRAW__)
+ * WINDOWS: Include windows.h here to define APIENTRY.
+ * It is also useful when applications include this file by
+ * including only glut.h, since glut.h depends on windows.h.
+ * Applications needing to include windows.h with parms other
+ * than "WIN32_LEAN_AND_MEAN" may include windows.h before
+ * glut.h or gl.h.
+ */
+#if defined(_WIN32) && !defined(APIENTRY) && !defined(__CYGWIN__)
+#define WIN32_LEAN_AND_MEAN 1
+#include <windows.h>
+#if defined(_WIN32) && !defined(_WINGDI_) && !defined(_GNU_H_WINDOWS32_DEFINES) && !defined(OPENSTEP) && !defined(__CYGWIN__)
+#include <GL/mesa_wgl.h>
+#if defined(macintosh) && PRAGMA_IMPORT_SUPPORTED
+#pragma import on
+#ifndef GLAPI
+#define GLAPI extern
+#ifndef APIENTRY
+/* "P" suffix to be used for a pointer to a function */
+#ifndef APIENTRYP
+#define signed
+#pragma export on
+#endif /* !__SCITECH_SNAP__ */
+ * End system-specific stuff.
+ **********************************************************************/
+#ifdef __cplusplus
+extern "C" {
+#define GL_VERSION_1_1 1
+#define GL_VERSION_1_2 1
+#define GL_VERSION_1_3 1
+#define GL_ARB_imaging 1
+ * Datatypes
+ */
+typedef unsigned int GLenum;
+typedef unsigned char GLboolean;
+typedef unsigned int GLbitfield;
+typedef void GLvoid;
+typedef signed char GLbyte; /* 1-byte signed */
+typedef short GLshort; /* 2-byte signed */
+typedef int GLint; /* 4-byte signed */
+typedef unsigned char GLubyte; /* 1-byte unsigned */
+typedef unsigned short GLushort; /* 2-byte unsigned */
+typedef unsigned int GLuint; /* 4-byte unsigned */
+typedef int GLsizei; /* 4-byte signed */
+typedef float GLfloat; /* single precision float */
+typedef float GLclampf; /* single precision float in [0,1] */
+typedef double GLdouble; /* double precision float */
+typedef double GLclampd; /* double precision float in [0,1] */
+ * Constants
+ */
+/* Boolean values */
+#define GL_FALSE 0x0
+#define GL_TRUE 0x1
+/* Data types */
+#define GL_BYTE 0x1400
+#define GL_UNSIGNED_BYTE 0x1401
+#define GL_SHORT 0x1402
+#define GL_UNSIGNED_SHORT 0x1403
+#define GL_INT 0x1404
+#define GL_UNSIGNED_INT 0x1405
+#define GL_FLOAT 0x1406
+#define GL_2_BYTES 0x1407
+#define GL_3_BYTES 0x1408
+#define GL_4_BYTES 0x1409
+#define GL_DOUBLE 0x140A
+/* Primitives */
+#define GL_POINTS 0x0000
+#define GL_LINES 0x0001
+#define GL_LINE_LOOP 0x0002
+#define GL_LINE_STRIP 0x0003
+#define GL_TRIANGLES 0x0004
+#define GL_TRIANGLE_STRIP 0x0005
+#define GL_TRIANGLE_FAN 0x0006
+#define GL_QUADS 0x0007
+#define GL_QUAD_STRIP 0x0008
+#define GL_POLYGON 0x0009
+/* Vertex Arrays */
+#define GL_VERTEX_ARRAY 0x8074
+#define GL_NORMAL_ARRAY 0x8075
+#define GL_COLOR_ARRAY 0x8076
+#define GL_INDEX_ARRAY 0x8077
+#define GL_TEXTURE_COORD_ARRAY 0x8078
+#define GL_EDGE_FLAG_ARRAY 0x8079
+#define GL_VERTEX_ARRAY_SIZE 0x807A
+#define GL_VERTEX_ARRAY_TYPE 0x807B
+#define GL_NORMAL_ARRAY_TYPE 0x807E
+#define GL_COLOR_ARRAY_SIZE 0x8081
+#define GL_COLOR_ARRAY_TYPE 0x8082
+#define GL_COLOR_ARRAY_STRIDE 0x8083
+#define GL_INDEX_ARRAY_TYPE 0x8085
+#define GL_INDEX_ARRAY_STRIDE 0x8086
+#define GL_COLOR_ARRAY_POINTER 0x8090
+#define GL_INDEX_ARRAY_POINTER 0x8091
+#define GL_V2F 0x2A20
+#define GL_V3F 0x2A21
+#define GL_C4UB_V2F 0x2A22
+#define GL_C4UB_V3F 0x2A23
+#define GL_C3F_V3F 0x2A24
+#define GL_N3F_V3F 0x2A25
+#define GL_C4F_N3F_V3F 0x2A26
+#define GL_T2F_V3F 0x2A27
+#define GL_T4F_V4F 0x2A28
+#define GL_T2F_C4UB_V3F 0x2A29
+#define GL_T2F_C3F_V3F 0x2A2A
+#define GL_T2F_N3F_V3F 0x2A2B
+#define GL_T2F_C4F_N3F_V3F 0x2A2C
+#define GL_T4F_C4F_N3F_V4F 0x2A2D
+/* Matrix Mode */
+#define GL_MATRIX_MODE 0x0BA0
+#define GL_MODELVIEW 0x1700
+#define GL_PROJECTION 0x1701
+#define GL_TEXTURE 0x1702
+/* Points */
+#define GL_POINT_SMOOTH 0x0B10
+#define GL_POINT_SIZE 0x0B11
+#define GL_POINT_SIZE_RANGE 0x0B12
+/* Lines */
+#define GL_LINE_SMOOTH 0x0B20
+#define GL_LINE_STIPPLE 0x0B24
+#define GL_LINE_WIDTH 0x0B21
+#define GL_LINE_WIDTH_RANGE 0x0B22
+/* Polygons */
+#define GL_POINT 0x1B00
+#define GL_LINE 0x1B01
+#define GL_FILL 0x1B02
+#define GL_CW 0x0900
+#define GL_CCW 0x0901
+#define GL_FRONT 0x0404
+#define GL_BACK 0x0405
+#define GL_POLYGON_MODE 0x0B40
+#define GL_POLYGON_SMOOTH 0x0B41
+#define GL_POLYGON_STIPPLE 0x0B42
+#define GL_EDGE_FLAG 0x0B43
+#define GL_CULL_FACE 0x0B44
+#define GL_CULL_FACE_MODE 0x0B45
+#define GL_FRONT_FACE 0x0B46
+#define GL_POLYGON_OFFSET_FILL 0x8037
+/* Display Lists */
+#define GL_COMPILE 0x1300
+#define GL_COMPILE_AND_EXECUTE 0x1301
+#define GL_LIST_BASE 0x0B32
+#define GL_LIST_INDEX 0x0B33
+#define GL_LIST_MODE 0x0B30
+/* Depth buffer */
+#define GL_NEVER 0x0200
+#define GL_LESS 0x0201
+#define GL_EQUAL 0x0202
+#define GL_LEQUAL 0x0203
+#define GL_GREATER 0x0204
+#define GL_NOTEQUAL 0x0205
+#define GL_GEQUAL 0x0206
+#define GL_ALWAYS 0x0207
+#define GL_DEPTH_TEST 0x0B71
+#define GL_DEPTH_BITS 0x0D56
+#define GL_DEPTH_CLEAR_VALUE 0x0B73
+#define GL_DEPTH_FUNC 0x0B74
+#define GL_DEPTH_RANGE 0x0B70
+#define GL_DEPTH_WRITEMASK 0x0B72
+#define GL_DEPTH_COMPONENT 0x1902
+/* Lighting */
+#define GL_LIGHTING 0x0B50
+#define GL_LIGHT0 0x4000
+#define GL_LIGHT1 0x4001
+#define GL_LIGHT2 0x4002
+#define GL_LIGHT3 0x4003
+#define GL_LIGHT4 0x4004
+#define GL_LIGHT5 0x4005
+#define GL_LIGHT6 0x4006
+#define GL_LIGHT7 0x4007
+#define GL_SPOT_EXPONENT 0x1205
+#define GL_SPOT_CUTOFF 0x1206
+#define GL_AMBIENT 0x1200
+#define GL_DIFFUSE 0x1201
+#define GL_SPECULAR 0x1202
+#define GL_SHININESS 0x1601
+#define GL_EMISSION 0x1600
+#define GL_POSITION 0x1203
+#define GL_SPOT_DIRECTION 0x1204
+#define GL_AMBIENT_AND_DIFFUSE 0x1602
+#define GL_COLOR_INDEXES 0x1603
+#define GL_FRONT_AND_BACK 0x0408
+#define GL_SHADE_MODEL 0x0B54
+#define GL_FLAT 0x1D00
+#define GL_SMOOTH 0x1D01
+#define GL_COLOR_MATERIAL 0x0B57
+#define GL_NORMALIZE 0x0BA1
+/* User clipping planes */
+#define GL_CLIP_PLANE0 0x3000
+#define GL_CLIP_PLANE1 0x3001
+#define GL_CLIP_PLANE2 0x3002
+#define GL_CLIP_PLANE3 0x3003
+#define GL_CLIP_PLANE4 0x3004
+#define GL_CLIP_PLANE5 0x3005
+/* Accumulation buffer */
+#define GL_ACCUM_RED_BITS 0x0D58
+#define GL_ACCUM_GREEN_BITS 0x0D59
+#define GL_ACCUM_BLUE_BITS 0x0D5A
+#define GL_ACCUM_CLEAR_VALUE 0x0B80
+#define GL_ACCUM 0x0100
+#define GL_ADD 0x0104
+#define GL_LOAD 0x0101
+#define GL_MULT 0x0103
+#define GL_RETURN 0x0102
+/* Alpha testing */
+#define GL_ALPHA_TEST 0x0BC0
+#define GL_ALPHA_TEST_REF 0x0BC2
+#define GL_ALPHA_TEST_FUNC 0x0BC1
+/* Blending */
+#define GL_BLEND 0x0BE2
+#define GL_BLEND_SRC 0x0BE1
+#define GL_BLEND_DST 0x0BE0
+#define GL_ZERO 0x0
+#define GL_ONE 0x1
+#define GL_SRC_COLOR 0x0300
+#define GL_ONE_MINUS_SRC_COLOR 0x0301
+#define GL_SRC_ALPHA 0x0302
+#define GL_ONE_MINUS_SRC_ALPHA 0x0303
+#define GL_DST_ALPHA 0x0304
+#define GL_ONE_MINUS_DST_ALPHA 0x0305
+#define GL_DST_COLOR 0x0306
+#define GL_ONE_MINUS_DST_COLOR 0x0307
+#define GL_SRC_ALPHA_SATURATE 0x0308
+/* Render Mode */
+#define GL_FEEDBACK 0x1C01
+#define GL_RENDER 0x1C00
+#define GL_SELECT 0x1C02
+/* Feedback */
+#define GL_2D 0x0600
+#define GL_3D 0x0601
+#define GL_3D_COLOR 0x0602
+#define GL_3D_COLOR_TEXTURE 0x0603
+#define GL_4D_COLOR_TEXTURE 0x0604
+#define GL_POINT_TOKEN 0x0701
+#define GL_LINE_TOKEN 0x0702
+#define GL_LINE_RESET_TOKEN 0x0707
+#define GL_POLYGON_TOKEN 0x0703
+#define GL_BITMAP_TOKEN 0x0704
+#define GL_DRAW_PIXEL_TOKEN 0x0705
+#define GL_COPY_PIXEL_TOKEN 0x0706
+#define GL_PASS_THROUGH_TOKEN 0x0700
+/* Selection */
+/* Fog */
+#define GL_FOG 0x0B60
+#define GL_FOG_MODE 0x0B65
+#define GL_FOG_DENSITY 0x0B62
+#define GL_FOG_COLOR 0x0B66
+#define GL_FOG_INDEX 0x0B61
+#define GL_FOG_START 0x0B63
+#define GL_FOG_END 0x0B64
+#define GL_LINEAR 0x2601
+#define GL_EXP 0x0800
+#define GL_EXP2 0x0801
+/* Logic Ops */
+#define GL_LOGIC_OP 0x0BF1
+#define GL_INDEX_LOGIC_OP 0x0BF1
+#define GL_COLOR_LOGIC_OP 0x0BF2
+#define GL_LOGIC_OP_MODE 0x0BF0
+#define GL_CLEAR 0x1500
+#define GL_SET 0x150F
+#define GL_COPY 0x1503
+#define GL_COPY_INVERTED 0x150C
+#define GL_NOOP 0x1505
+#define GL_INVERT 0x150A
+#define GL_AND 0x1501
+#define GL_NAND 0x150E
+#define GL_OR 0x1507
+#define GL_NOR 0x1508
+#define GL_XOR 0x1506
+#define GL_EQUIV 0x1509
+#define GL_AND_REVERSE 0x1502
+#define GL_AND_INVERTED 0x1504
+#define GL_OR_REVERSE 0x150B
+#define GL_OR_INVERTED 0x150D
+/* Stencil */
+#define GL_STENCIL_BITS 0x0D57
+#define GL_STENCIL_TEST 0x0B90
+#define GL_STENCIL_FUNC 0x0B92
+#define GL_STENCIL_FAIL 0x0B94
+#define GL_STENCIL_REF 0x0B97
+#define GL_STENCIL_INDEX 0x1901
+#define GL_KEEP 0x1E00
+#define GL_REPLACE 0x1E01
+#define GL_INCR 0x1E02
+#define GL_DECR 0x1E03
+/* Buffers, Pixel Drawing/Reading */
+#define GL_NONE 0x0
+#define GL_LEFT 0x0406
+#define GL_RIGHT 0x0407
+/*GL_FRONT 0x0404 */
+/*GL_BACK 0x0405 */
+/*GL_FRONT_AND_BACK 0x0408 */
+#define GL_FRONT_LEFT 0x0400
+#define GL_FRONT_RIGHT 0x0401
+#define GL_BACK_LEFT 0x0402
+#define GL_BACK_RIGHT 0x0403
+#define GL_AUX0 0x0409
+#define GL_AUX1 0x040A
+#define GL_AUX2 0x040B
+#define GL_AUX3 0x040C
+#define GL_COLOR_INDEX 0x1900
+#define GL_RED 0x1903
+#define GL_GREEN 0x1904
+#define GL_BLUE 0x1905
+#define GL_ALPHA 0x1906
+#define GL_LUMINANCE 0x1909
+#define GL_LUMINANCE_ALPHA 0x190A
+#define GL_ALPHA_BITS 0x0D55
+#define GL_RED_BITS 0x0D52
+#define GL_GREEN_BITS 0x0D53
+#define GL_BLUE_BITS 0x0D54
+#define GL_INDEX_BITS 0x0D51
+#define GL_SUBPIXEL_BITS 0x0D50
+#define GL_AUX_BUFFERS 0x0C00
+#define GL_READ_BUFFER 0x0C02
+#define GL_DRAW_BUFFER 0x0C01
+#define GL_DOUBLEBUFFER 0x0C32
+#define GL_STEREO 0x0C33
+#define GL_BITMAP 0x1A00
+#define GL_COLOR 0x1800
+#define GL_DEPTH 0x1801
+#define GL_STENCIL 0x1802
+#define GL_DITHER 0x0BD0
+#define GL_RGB 0x1907
+#define GL_RGBA 0x1908
+/* Implementation limits */
+#define GL_MAX_LIST_NESTING 0x0B31
+#define GL_MAX_EVAL_ORDER 0x0D30
+#define GL_MAX_LIGHTS 0x0D31
+#define GL_MAX_CLIP_PLANES 0x0D32
+#define GL_MAX_TEXTURE_SIZE 0x0D33
+#define GL_MAX_PIXEL_MAP_TABLE 0x0D34
+/* Gets */
+#define GL_COLOR_CLEAR_VALUE 0x0C22
+#define GL_COLOR_WRITEMASK 0x0C23
+#define GL_CURRENT_INDEX 0x0B01
+#define GL_CURRENT_COLOR 0x0B00
+#define GL_CURRENT_NORMAL 0x0B02
+#define GL_INDEX_CLEAR_VALUE 0x0C20
+#define GL_INDEX_MODE 0x0C30
+#define GL_INDEX_WRITEMASK 0x0C21
+#define GL_NAME_STACK_DEPTH 0x0D70
+#define GL_RENDER_MODE 0x0C40
+#define GL_RGBA_MODE 0x0C31
+#define GL_VIEWPORT 0x0BA2
+/* Evaluators */
+#define GL_AUTO_NORMAL 0x0D80
+#define GL_MAP1_COLOR_4 0x0D90
+#define GL_MAP1_INDEX 0x0D91
+#define GL_MAP1_NORMAL 0x0D92
+#define GL_MAP1_TEXTURE_COORD_1 0x0D93
+#define GL_MAP1_TEXTURE_COORD_2 0x0D94
+#define GL_MAP1_TEXTURE_COORD_3 0x0D95
+#define GL_MAP1_TEXTURE_COORD_4 0x0D96
+#define GL_MAP1_VERTEX_3 0x0D97
+#define GL_MAP1_VERTEX_4 0x0D98
+#define GL_MAP2_COLOR_4 0x0DB0
+#define GL_MAP2_INDEX 0x0DB1
+#define GL_MAP2_NORMAL 0x0DB2
+#define GL_MAP2_TEXTURE_COORD_1 0x0DB3
+#define GL_MAP2_TEXTURE_COORD_2 0x0DB4
+#define GL_MAP2_TEXTURE_COORD_3 0x0DB5
+#define GL_MAP2_TEXTURE_COORD_4 0x0DB6
+#define GL_MAP2_VERTEX_3 0x0DB7
+#define GL_MAP2_VERTEX_4 0x0DB8
+#define GL_MAP1_GRID_DOMAIN 0x0DD0
+#define GL_MAP2_GRID_DOMAIN 0x0DD2
+#define GL_COEFF 0x0A00
+#define GL_ORDER 0x0A01
+#define GL_DOMAIN 0x0A02
+/* Hints */
+#define GL_POINT_SMOOTH_HINT 0x0C51
+#define GL_LINE_SMOOTH_HINT 0x0C52
+#define GL_FOG_HINT 0x0C54
+#define GL_DONT_CARE 0x1100
+#define GL_FASTEST 0x1101
+#define GL_NICEST 0x1102
+/* Scissor box */
+#define GL_SCISSOR_BOX 0x0C10
+#define GL_SCISSOR_TEST 0x0C11
+/* Pixel Mode / Transfer */
+#define GL_MAP_COLOR 0x0D10
+#define GL_MAP_STENCIL 0x0D11
+#define GL_INDEX_SHIFT 0x0D12
+#define GL_INDEX_OFFSET 0x0D13
+#define GL_RED_SCALE 0x0D14
+#define GL_RED_BIAS 0x0D15
+#define GL_GREEN_SCALE 0x0D18
+#define GL_GREEN_BIAS 0x0D19
+#define GL_BLUE_SCALE 0x0D1A
+#define GL_BLUE_BIAS 0x0D1B
+#define GL_ALPHA_SCALE 0x0D1C
+#define GL_ALPHA_BIAS 0x0D1D
+#define GL_DEPTH_SCALE 0x0D1E
+#define GL_DEPTH_BIAS 0x0D1F
+#define GL_PIXEL_MAP_S_TO_S_SIZE 0x0CB1
+#define GL_PIXEL_MAP_I_TO_I_SIZE 0x0CB0
+#define GL_PIXEL_MAP_I_TO_R_SIZE 0x0CB2
+#define GL_PIXEL_MAP_I_TO_G_SIZE 0x0CB3
+#define GL_PIXEL_MAP_I_TO_B_SIZE 0x0CB4
+#define GL_PIXEL_MAP_I_TO_A_SIZE 0x0CB5
+#define GL_PIXEL_MAP_R_TO_R_SIZE 0x0CB6
+#define GL_PIXEL_MAP_G_TO_G_SIZE 0x0CB7
+#define GL_PIXEL_MAP_B_TO_B_SIZE 0x0CB8
+#define GL_PIXEL_MAP_A_TO_A_SIZE 0x0CB9
+#define GL_PIXEL_MAP_S_TO_S 0x0C71
+#define GL_PIXEL_MAP_I_TO_I 0x0C70
+#define GL_PIXEL_MAP_I_TO_R 0x0C72
+#define GL_PIXEL_MAP_I_TO_G 0x0C73
+#define GL_PIXEL_MAP_I_TO_B 0x0C74
+#define GL_PIXEL_MAP_I_TO_A 0x0C75
+#define GL_PIXEL_MAP_R_TO_R 0x0C76
+#define GL_PIXEL_MAP_G_TO_G 0x0C77
+#define GL_PIXEL_MAP_B_TO_B 0x0C78
+#define GL_PIXEL_MAP_A_TO_A 0x0C79
+#define GL_PACK_ALIGNMENT 0x0D05
+#define GL_PACK_LSB_FIRST 0x0D01
+#define GL_PACK_ROW_LENGTH 0x0D02
+#define GL_PACK_SKIP_PIXELS 0x0D04
+#define GL_PACK_SKIP_ROWS 0x0D03
+#define GL_PACK_SWAP_BYTES 0x0D00
+#define GL_ZOOM_X 0x0D16
+#define GL_ZOOM_Y 0x0D17
+/* Texture mapping */
+#define GL_TEXTURE_ENV 0x2300
+#define GL_TEXTURE_ENV_MODE 0x2200
+#define GL_TEXTURE_1D 0x0DE0
+#define GL_TEXTURE_2D 0x0DE1
+#define GL_TEXTURE_WRAP_S 0x2802
+#define GL_TEXTURE_WRAP_T 0x2803
+#define GL_TEXTURE_MAG_FILTER 0x2800
+#define GL_TEXTURE_MIN_FILTER 0x2801
+#define GL_TEXTURE_ENV_COLOR 0x2201
+#define GL_TEXTURE_GEN_S 0x0C60
+#define GL_TEXTURE_GEN_T 0x0C61
+#define GL_TEXTURE_GEN_MODE 0x2500
+#define GL_TEXTURE_WIDTH 0x1000
+#define GL_TEXTURE_HEIGHT 0x1001
+#define GL_TEXTURE_BORDER 0x1005
+#define GL_TEXTURE_RED_SIZE 0x805C
+#define GL_TEXTURE_BLUE_SIZE 0x805E
+#define GL_OBJECT_LINEAR 0x2401
+#define GL_OBJECT_PLANE 0x2501
+#define GL_EYE_LINEAR 0x2400
+#define GL_EYE_PLANE 0x2502
+#define GL_SPHERE_MAP 0x2402
+#define GL_DECAL 0x2101
+#define GL_MODULATE 0x2100
+#define GL_NEAREST 0x2600
+#define GL_REPEAT 0x2901
+#define GL_CLAMP 0x2900
+#define GL_S 0x2000
+#define GL_T 0x2001
+#define GL_R 0x2002
+#define GL_Q 0x2003
+#define GL_TEXTURE_GEN_R 0x0C62
+#define GL_TEXTURE_GEN_Q 0x0C63
+/* Utility */
+#define GL_VENDOR 0x1F00
+#define GL_RENDERER 0x1F01
+#define GL_VERSION 0x1F02
+#define GL_EXTENSIONS 0x1F03
+/* Errors */
+#define GL_NO_ERROR 0x0
+#define GL_INVALID_ENUM 0x0500
+#define GL_INVALID_VALUE 0x0501
+#define GL_INVALID_OPERATION 0x0502
+#define GL_STACK_OVERFLOW 0x0503
+#define GL_STACK_UNDERFLOW 0x0504
+#define GL_OUT_OF_MEMORY 0x0505
+/* glPush/PopAttrib bits */
+#define GL_CURRENT_BIT 0x00000001
+#define GL_POINT_BIT 0x00000002
+#define GL_LINE_BIT 0x00000004
+#define GL_POLYGON_BIT 0x00000008
+#define GL_POLYGON_STIPPLE_BIT 0x00000010
+#define GL_PIXEL_MODE_BIT 0x00000020
+#define GL_LIGHTING_BIT 0x00000040
+#define GL_FOG_BIT 0x00000080
+#define GL_DEPTH_BUFFER_BIT 0x00000100
+#define GL_ACCUM_BUFFER_BIT 0x00000200
+#define GL_STENCIL_BUFFER_BIT 0x00000400
+#define GL_VIEWPORT_BIT 0x00000800
+#define GL_TRANSFORM_BIT 0x00001000
+#define GL_ENABLE_BIT 0x00002000
+#define GL_COLOR_BUFFER_BIT 0x00004000
+#define GL_HINT_BIT 0x00008000
+#define GL_EVAL_BIT 0x00010000
+#define GL_LIST_BIT 0x00020000
+#define GL_TEXTURE_BIT 0x00040000
+#define GL_SCISSOR_BIT 0x00080000
+/* OpenGL 1.1 */
+#define GL_PROXY_TEXTURE_1D 0x8063
+#define GL_PROXY_TEXTURE_2D 0x8064
+#define GL_TEXTURE_PRIORITY 0x8066
+#define GL_TEXTURE_RESIDENT 0x8067
+#define GL_TEXTURE_BINDING_1D 0x8068
+#define GL_TEXTURE_BINDING_2D 0x8069
+#define GL_ALPHA4 0x803B
+#define GL_ALPHA8 0x803C
+#define GL_ALPHA12 0x803D
+#define GL_ALPHA16 0x803E
+#define GL_LUMINANCE4 0x803F
+#define GL_LUMINANCE8 0x8040
+#define GL_LUMINANCE12 0x8041
+#define GL_LUMINANCE16 0x8042
+#define GL_LUMINANCE4_ALPHA4 0x8043
+#define GL_LUMINANCE6_ALPHA2 0x8044
+#define GL_LUMINANCE8_ALPHA8 0x8045
+#define GL_LUMINANCE12_ALPHA4 0x8046
+#define GL_LUMINANCE12_ALPHA12 0x8047
+#define GL_LUMINANCE16_ALPHA16 0x8048
+#define GL_INTENSITY 0x8049
+#define GL_INTENSITY4 0x804A
+#define GL_INTENSITY8 0x804B
+#define GL_INTENSITY12 0x804C
+#define GL_INTENSITY16 0x804D
+#define GL_R3_G3_B2 0x2A10
+#define GL_RGB4 0x804F
+#define GL_RGB5 0x8050
+#define GL_RGB8 0x8051
+#define GL_RGB10 0x8052
+#define GL_RGB12 0x8053
+#define GL_RGB16 0x8054
+#define GL_RGBA2 0x8055
+#define GL_RGBA4 0x8056
+#define GL_RGB5_A1 0x8057
+#define GL_RGBA8 0x8058
+#define GL_RGB10_A2 0x8059
+#define GL_RGBA12 0x805A
+#define GL_RGBA16 0x805B
+#define GL_CLIENT_PIXEL_STORE_BIT 0x00000001
+#define GL_CLIENT_VERTEX_ARRAY_BIT 0x00000002
+ * Miscellaneous
+ */
+GLAPI void GLAPIENTRY glClearIndex( GLfloat c );
+GLAPI void GLAPIENTRY glClearColor( GLclampf red, GLclampf green, GLclampf blue, GLclampf alpha );
+GLAPI void GLAPIENTRY glClear( GLbitfield mask );
+GLAPI void GLAPIENTRY glIndexMask( GLuint mask );
+GLAPI void GLAPIENTRY glColorMask( GLboolean red, GLboolean green, GLboolean blue, GLboolean alpha );
+GLAPI void GLAPIENTRY glAlphaFunc( GLenum func, GLclampf ref );
+GLAPI void GLAPIENTRY glBlendFunc( GLenum sfactor, GLenum dfactor );
+GLAPI void GLAPIENTRY glLogicOp( GLenum opcode );
+GLAPI void GLAPIENTRY glCullFace( GLenum mode );
+GLAPI void GLAPIENTRY glFrontFace( GLenum mode );
+GLAPI void GLAPIENTRY glPointSize( GLfloat size );
+GLAPI void GLAPIENTRY glLineWidth( GLfloat width );
+GLAPI void GLAPIENTRY glLineStipple( GLint factor, GLushort pattern );
+GLAPI void GLAPIENTRY glPolygonMode( GLenum face, GLenum mode );
+GLAPI void GLAPIENTRY glPolygonOffset( GLfloat factor, GLfloat units );
+GLAPI void GLAPIENTRY glPolygonStipple( const GLubyte *mask );
+GLAPI void GLAPIENTRY glGetPolygonStipple( GLubyte *mask );
+GLAPI void GLAPIENTRY glEdgeFlag( GLboolean flag );
+GLAPI void GLAPIENTRY glEdgeFlagv( const GLboolean *flag );
+GLAPI void GLAPIENTRY glScissor( GLint x, GLint y, GLsizei width, GLsizei height);
+GLAPI void GLAPIENTRY glClipPlane( GLenum plane, const GLdouble *equation );
+GLAPI void GLAPIENTRY glGetClipPlane( GLenum plane, GLdouble *equation );
+GLAPI void GLAPIENTRY glDrawBuffer( GLenum mode );
+GLAPI void GLAPIENTRY glReadBuffer( GLenum mode );
+GLAPI void GLAPIENTRY glEnable( GLenum cap );
+GLAPI void GLAPIENTRY glDisable( GLenum cap );
+GLAPI GLboolean GLAPIENTRY glIsEnabled( GLenum cap );
+GLAPI void GLAPIENTRY glEnableClientState( GLenum cap ); /* 1.1 */
+GLAPI void GLAPIENTRY glDisableClientState( GLenum cap ); /* 1.1 */
+GLAPI void GLAPIENTRY glGetBooleanv( GLenum pname, GLboolean *params );
+GLAPI void GLAPIENTRY glGetDoublev( GLenum pname, GLdouble *params );
+GLAPI void GLAPIENTRY glGetFloatv( GLenum pname, GLfloat *params );
+GLAPI void GLAPIENTRY glGetIntegerv( GLenum pname, GLint *params );
+GLAPI void GLAPIENTRY glPushAttrib( GLbitfield mask );
+GLAPI void GLAPIENTRY glPopAttrib( void );
+GLAPI void GLAPIENTRY glPushClientAttrib( GLbitfield mask ); /* 1.1 */
+GLAPI void GLAPIENTRY glPopClientAttrib( void ); /* 1.1 */
+GLAPI GLint GLAPIENTRY glRenderMode( GLenum mode );
+GLAPI GLenum GLAPIENTRY glGetError( void );
+GLAPI const GLubyte * GLAPIENTRY glGetString( GLenum name );
+GLAPI void GLAPIENTRY glFinish( void );
+GLAPI void GLAPIENTRY glFlush( void );
+GLAPI void GLAPIENTRY glHint( GLenum target, GLenum mode );
+ * Depth Buffer
+ */
+GLAPI void GLAPIENTRY glClearDepth( GLclampd depth );
+GLAPI void GLAPIENTRY glDepthFunc( GLenum func );
+GLAPI void GLAPIENTRY glDepthMask( GLboolean flag );
+GLAPI void GLAPIENTRY glDepthRange( GLclampd near_val, GLclampd far_val );
+ * Accumulation Buffer
+ */
+GLAPI void GLAPIENTRY glClearAccum( GLfloat red, GLfloat green, GLfloat blue, GLfloat alpha );
+GLAPI void GLAPIENTRY glAccum( GLenum op, GLfloat value );
+ * Transformation
+ */
+GLAPI void GLAPIENTRY glMatrixMode( GLenum mode );
+GLAPI void GLAPIENTRY glOrtho( GLdouble left, GLdouble right,
+ GLdouble bottom, GLdouble top,
+ GLdouble near_val, GLdouble far_val );
+GLAPI void GLAPIENTRY glFrustum( GLdouble left, GLdouble right,
+ GLdouble bottom, GLdouble top,
+ GLdouble near_val, GLdouble far_val );
+GLAPI void GLAPIENTRY glViewport( GLint x, GLint y,
+ GLsizei width, GLsizei height );
+GLAPI void GLAPIENTRY glPushMatrix( void );
+GLAPI void GLAPIENTRY glPopMatrix( void );
+GLAPI void GLAPIENTRY glLoadIdentity( void );
+GLAPI void GLAPIENTRY glLoadMatrixd( const GLdouble *m );
+GLAPI void GLAPIENTRY glLoadMatrixf( const GLfloat *m );
+GLAPI void GLAPIENTRY glMultMatrixd( const GLdouble *m );
+GLAPI void GLAPIENTRY glMultMatrixf( const GLfloat *m );
+GLAPI void GLAPIENTRY glRotated( GLdouble angle,
+ GLdouble x, GLdouble y, GLdouble z );
+GLAPI void GLAPIENTRY glRotatef( GLfloat angle,
+ GLfloat x, GLfloat y, GLfloat z );
+GLAPI void GLAPIENTRY glScaled( GLdouble x, GLdouble y, GLdouble z );
+GLAPI void GLAPIENTRY glScalef( GLfloat x, GLfloat y, GLfloat z );
+GLAPI void GLAPIENTRY glTranslated( GLdouble x, GLdouble y, GLdouble z );
+GLAPI void GLAPIENTRY glTranslatef( GLfloat x, GLfloat y, GLfloat z );
+ * Display Lists
+ */
+GLAPI GLboolean GLAPIENTRY glIsList( GLuint list );
+GLAPI void GLAPIENTRY glDeleteLists( GLuint list, GLsizei range );
+GLAPI GLuint GLAPIENTRY glGenLists( GLsizei range );
+GLAPI void GLAPIENTRY glNewList( GLuint list, GLenum mode );
+GLAPI void GLAPIENTRY glEndList( void );
+GLAPI void GLAPIENTRY glCallList( GLuint list );
+GLAPI void GLAPIENTRY glCallLists( GLsizei n, GLenum type,
+ const GLvoid *lists );
+GLAPI void GLAPIENTRY glListBase( GLuint base );
+ * Drawing Functions
+ */
+GLAPI void GLAPIENTRY glBegin( GLenum mode );
+GLAPI void GLAPIENTRY glEnd( void );
+GLAPI void GLAPIENTRY glVertex2d( GLdouble x, GLdouble y );
+GLAPI void GLAPIENTRY glVertex2f( GLfloat x, GLfloat y );
+GLAPI void GLAPIENTRY glVertex2i( GLint x, GLint y );
+GLAPI void GLAPIENTRY glVertex2s( GLshort x, GLshort y );
+GLAPI void GLAPIENTRY glVertex3d( GLdouble x, GLdouble y, GLdouble z );
+GLAPI void GLAPIENTRY glVertex3f( GLfloat x, GLfloat y, GLfloat z );
+GLAPI void GLAPIENTRY glVertex3i( GLint x, GLint y, GLint z );
+GLAPI void GLAPIENTRY glVertex3s( GLshort x, GLshort y, GLshort z );
+GLAPI void GLAPIENTRY glVertex4d( GLdouble x, GLdouble y, GLdouble z, GLdouble w );
+GLAPI void GLAPIENTRY glVertex4f( GLfloat x, GLfloat y, GLfloat z, GLfloat w );
+GLAPI void GLAPIENTRY glVertex4i( GLint x, GLint y, GLint z, GLint w );
+GLAPI void GLAPIENTRY glVertex4s( GLshort x, GLshort y, GLshort z, GLshort w );
+GLAPI void GLAPIENTRY glVertex2dv( const GLdouble *v );
+GLAPI void GLAPIENTRY glVertex2fv( const GLfloat *v );
+GLAPI void GLAPIENTRY glVertex2iv( const GLint *v );
+GLAPI void GLAPIENTRY glVertex2sv( const GLshort *v );
+GLAPI void GLAPIENTRY glVertex3dv( const GLdouble *v );
+GLAPI void GLAPIENTRY glVertex3fv( const GLfloat *v );
+GLAPI void GLAPIENTRY glVertex3iv( const GLint *v );
+GLAPI void GLAPIENTRY glVertex3sv( const GLshort *v );
+GLAPI void GLAPIENTRY glVertex4dv( const GLdouble *v );
+GLAPI void GLAPIENTRY glVertex4fv( const GLfloat *v );
+GLAPI void GLAPIENTRY glVertex4iv( const GLint *v );
+GLAPI void GLAPIENTRY glVertex4sv( const GLshort *v );
+GLAPI void GLAPIENTRY glNormal3b( GLbyte nx, GLbyte ny, GLbyte nz );
+GLAPI void GLAPIENTRY glNormal3d( GLdouble nx, GLdouble ny, GLdouble nz );
+GLAPI void GLAPIENTRY glNormal3f( GLfloat nx, GLfloat ny, GLfloat nz );
+GLAPI void GLAPIENTRY glNormal3i( GLint nx, GLint ny, GLint nz );
+GLAPI void GLAPIENTRY glNormal3s( GLshort nx, GLshort ny, GLshort nz );
+GLAPI void GLAPIENTRY glNormal3bv( const GLbyte *v );
+GLAPI void GLAPIENTRY glNormal3dv( const GLdouble *v );
+GLAPI void GLAPIENTRY glNormal3fv( const GLfloat *v );
+GLAPI void GLAPIENTRY glNormal3iv( const GLint *v );
+GLAPI void GLAPIENTRY glNormal3sv( const GLshort *v );
+GLAPI void GLAPIENTRY glIndexd( GLdouble c );
+GLAPI void GLAPIENTRY glIndexf( GLfloat c );
+GLAPI void GLAPIENTRY glIndexi( GLint c );
+GLAPI void GLAPIENTRY glIndexs( GLshort c );
+GLAPI void GLAPIENTRY glIndexub( GLubyte c ); /* 1.1 */
+GLAPI void GLAPIENTRY glIndexdv( const GLdouble *c );
+GLAPI void GLAPIENTRY glIndexfv( const GLfloat *c );
+GLAPI void GLAPIENTRY glIndexiv( const GLint *c );
+GLAPI void GLAPIENTRY glIndexsv( const GLshort *c );
+GLAPI void GLAPIENTRY glIndexubv( const GLubyte *c ); /* 1.1 */
+GLAPI void GLAPIENTRY glColor3b( GLbyte red, GLbyte green, GLbyte blue );
+GLAPI void GLAPIENTRY glColor3d( GLdouble red, GLdouble green, GLdouble blue );
+GLAPI void GLAPIENTRY glColor3f( GLfloat red, GLfloat green, GLfloat blue );
+GLAPI void GLAPIENTRY glColor3i( GLint red, GLint green, GLint blue );
+GLAPI void GLAPIENTRY glColor3s( GLshort red, GLshort green, GLshort blue );
+GLAPI void GLAPIENTRY glColor3ub( GLubyte red, GLubyte green, GLubyte blue );
+GLAPI void GLAPIENTRY glColor3ui( GLuint red, GLuint green, GLuint blue );
+GLAPI void GLAPIENTRY glColor3us( GLushort red, GLushort green, GLushort blue );
+GLAPI void GLAPIENTRY glColor4b( GLbyte red, GLbyte green,
+ GLbyte blue, GLbyte alpha );
+GLAPI void GLAPIENTRY glColor4d( GLdouble red, GLdouble green,
+ GLdouble blue, GLdouble alpha );
+GLAPI void GLAPIENTRY glColor4f( GLfloat red, GLfloat green,
+ GLfloat blue, GLfloat alpha );
+GLAPI void GLAPIENTRY glColor4i( GLint red, GLint green,
+ GLint blue, GLint alpha );
+GLAPI void GLAPIENTRY glColor4s( GLshort red, GLshort green,
+ GLshort blue, GLshort alpha );
+GLAPI void GLAPIENTRY glColor4ub( GLubyte red, GLubyte green,
+ GLubyte blue, GLubyte alpha );
+GLAPI void GLAPIENTRY glColor4ui( GLuint red, GLuint green,
+ GLuint blue, GLuint alpha );
+GLAPI void GLAPIENTRY glColor4us( GLushort red, GLushort green,
+ GLushort blue, GLushort alpha );
+GLAPI void GLAPIENTRY glColor3bv( const GLbyte *v );
+GLAPI void GLAPIENTRY glColor3dv( const GLdouble *v );
+GLAPI void GLAPIENTRY glColor3fv( const GLfloat *v );
+GLAPI void GLAPIENTRY glColor3iv( const GLint *v );
+GLAPI void GLAPIENTRY glColor3sv( const GLshort *v );
+GLAPI void GLAPIENTRY glColor3ubv( const GLubyte *v );
+GLAPI void GLAPIENTRY glColor3uiv( const GLuint *v );
+GLAPI void GLAPIENTRY glColor3usv( const GLushort *v );
+GLAPI void GLAPIENTRY glColor4bv( const GLbyte *v );
+GLAPI void GLAPIENTRY glColor4dv( const GLdouble *v );
+GLAPI void GLAPIENTRY glColor4fv( const GLfloat *v );
+GLAPI void GLAPIENTRY glColor4iv( const GLint *v );
+GLAPI void GLAPIENTRY glColor4sv( const GLshort *v );
+GLAPI void GLAPIENTRY glColor4ubv( const GLubyte *v );
+GLAPI void GLAPIENTRY glColor4uiv( const GLuint *v );
+GLAPI void GLAPIENTRY glColor4usv( const GLushort *v );
+GLAPI void GLAPIENTRY glTexCoord1d( GLdouble s );
+GLAPI void GLAPIENTRY glTexCoord1f( GLfloat s );
+GLAPI void GLAPIENTRY glTexCoord1i( GLint s );
+GLAPI void GLAPIENTRY glTexCoord1s( GLshort s );
+GLAPI void GLAPIENTRY glTexCoord2d( GLdouble s, GLdouble t );
+GLAPI void GLAPIENTRY glTexCoord2f( GLfloat s, GLfloat t );
+GLAPI void GLAPIENTRY glTexCoord2i( GLint s, GLint t );
+GLAPI void GLAPIENTRY glTexCoord2s( GLshort s, GLshort t );
+GLAPI void GLAPIENTRY glTexCoord3d( GLdouble s, GLdouble t, GLdouble r );
+GLAPI void GLAPIENTRY glTexCoord3f( GLfloat s, GLfloat t, GLfloat r );
+GLAPI void GLAPIENTRY glTexCoord3i( GLint s, GLint t, GLint r );
+GLAPI void GLAPIENTRY glTexCoord3s( GLshort s, GLshort t, GLshort r );
+GLAPI void GLAPIENTRY glTexCoord4d( GLdouble s, GLdouble t, GLdouble r, GLdouble q );
+GLAPI void GLAPIENTRY glTexCoord4f( GLfloat s, GLfloat t, GLfloat r, GLfloat q );
+GLAPI void GLAPIENTRY glTexCoord4i( GLint s, GLint t, GLint r, GLint q );
+GLAPI void GLAPIENTRY glTexCoord4s( GLshort s, GLshort t, GLshort r, GLshort q );
+GLAPI void GLAPIENTRY glTexCoord1dv( const GLdouble *v );
+GLAPI void GLAPIENTRY glTexCoord1fv( const GLfloat *v );
+GLAPI void GLAPIENTRY glTexCoord1iv( const GLint *v );
+GLAPI void GLAPIENTRY glTexCoord1sv( const GLshort *v );
+GLAPI void GLAPIENTRY glTexCoord2dv( const GLdouble *v );
+GLAPI void GLAPIENTRY glTexCoord2fv( const GLfloat *v );
+GLAPI void GLAPIENTRY glTexCoord2iv( const GLint *v );
+GLAPI void GLAPIENTRY glTexCoord2sv( const GLshort *v );
+GLAPI void GLAPIENTRY glTexCoord3dv( const GLdouble *v );
+GLAPI void GLAPIENTRY glTexCoord3fv( const GLfloat *v );
+GLAPI void GLAPIENTRY glTexCoord3iv( const GLint *v );
+GLAPI void GLAPIENTRY glTexCoord3sv( const GLshort *v );
+GLAPI void GLAPIENTRY glTexCoord4dv( const GLdouble *v );
+GLAPI void GLAPIENTRY glTexCoord4fv( const GLfloat *v );
+GLAPI void GLAPIENTRY glTexCoord4iv( const GLint *v );
+GLAPI void GLAPIENTRY glTexCoord4sv( const GLshort *v );
+GLAPI void GLAPIENTRY glRasterPos2d( GLdouble x, GLdouble y );
+GLAPI void GLAPIENTRY glRasterPos2f( GLfloat x, GLfloat y );
+GLAPI void GLAPIENTRY glRasterPos2i( GLint x, GLint y );
+GLAPI void GLAPIENTRY glRasterPos2s( GLshort x, GLshort y );
+GLAPI void GLAPIENTRY glRasterPos3d( GLdouble x, GLdouble y, GLdouble z );
+GLAPI void GLAPIENTRY glRasterPos3f( GLfloat x, GLfloat y, GLfloat z );
+GLAPI void GLAPIENTRY glRasterPos3i( GLint x, GLint y, GLint z );
+GLAPI void GLAPIENTRY glRasterPos3s( GLshort x, GLshort y, GLshort z );
+GLAPI void GLAPIENTRY glRasterPos4d( GLdouble x, GLdouble y, GLdouble z, GLdouble w );
+GLAPI void GLAPIENTRY glRasterPos4f( GLfloat x, GLfloat y, GLfloat z, GLfloat w );
+GLAPI void GLAPIENTRY glRasterPos4i( GLint x, GLint y, GLint z, GLint w );
+GLAPI void GLAPIENTRY glRasterPos4s( GLshort x, GLshort y, GLshort z, GLshort w );
+GLAPI void GLAPIENTRY glRasterPos2dv( const GLdouble *v );
+GLAPI void GLAPIENTRY glRasterPos2fv( const GLfloat *v );
+GLAPI void GLAPIENTRY glRasterPos2iv( const GLint *v );
+GLAPI void GLAPIENTRY glRasterPos2sv( const GLshort *v );
+GLAPI void GLAPIENTRY glRasterPos3dv( const GLdouble *v );
+GLAPI void GLAPIENTRY glRasterPos3fv( const GLfloat *v );
+GLAPI void GLAPIENTRY glRasterPos3iv( const GLint *v );
+GLAPI void GLAPIENTRY glRasterPos3sv( const GLshort *v );
+GLAPI void GLAPIENTRY glRasterPos4dv( const GLdouble *v );
+GLAPI void GLAPIENTRY glRasterPos4fv( const GLfloat *v );
+GLAPI void GLAPIENTRY glRasterPos4iv( const GLint *v );
+GLAPI void GLAPIENTRY glRasterPos4sv( const GLshort *v );
+GLAPI void GLAPIENTRY glRectd( GLdouble x1, GLdouble y1, GLdouble x2, GLdouble y2 );
+GLAPI void GLAPIENTRY glRectf( GLfloat x1, GLfloat y1, GLfloat x2, GLfloat y2 );
+GLAPI void GLAPIENTRY glRecti( GLint x1, GLint y1, GLint x2, GLint y2 );
+GLAPI void GLAPIENTRY glRects( GLshort x1, GLshort y1, GLshort x2, GLshort y2 );
+GLAPI void GLAPIENTRY glRectdv( const GLdouble *v1, const GLdouble *v2 );
+GLAPI void GLAPIENTRY glRectfv( const GLfloat *v1, const GLfloat *v2 );
+GLAPI void GLAPIENTRY glRectiv( const GLint *v1, const GLint *v2 );
+GLAPI void GLAPIENTRY glRectsv( const GLshort *v1, const GLshort *v2 );
+ * Vertex Arrays (1.1)
+ */
+GLAPI void GLAPIENTRY glVertexPointer( GLint size, GLenum type,
+ GLsizei stride, const GLvoid *ptr );
+GLAPI void GLAPIENTRY glNormalPointer( GLenum type, GLsizei stride,
+ const GLvoid *ptr );
+GLAPI void GLAPIENTRY glColorPointer( GLint size, GLenum type,
+ GLsizei stride, const GLvoid *ptr );
+GLAPI void GLAPIENTRY glIndexPointer( GLenum type, GLsizei stride,
+ const GLvoid *ptr );
+GLAPI void GLAPIENTRY glTexCoordPointer( GLint size, GLenum type,
+ GLsizei stride, const GLvoid *ptr );
+GLAPI void GLAPIENTRY glEdgeFlagPointer( GLsizei stride, const GLvoid *ptr );
+GLAPI void GLAPIENTRY glGetPointerv( GLenum pname, GLvoid **params );
+GLAPI void GLAPIENTRY glArrayElement( GLint i );
+GLAPI void GLAPIENTRY glDrawArrays( GLenum mode, GLint first, GLsizei count );
+GLAPI void GLAPIENTRY glDrawElements( GLenum mode, GLsizei count,
+ GLenum type, const GLvoid *indices );
+GLAPI void GLAPIENTRY glInterleavedArrays( GLenum format, GLsizei stride,
+ const GLvoid *pointer );
+ * Lighting
+ */
+GLAPI void GLAPIENTRY glShadeModel( GLenum mode );
+GLAPI void GLAPIENTRY glLightf( GLenum light, GLenum pname, GLfloat param );
+GLAPI void GLAPIENTRY glLighti( GLenum light, GLenum pname, GLint param );
+GLAPI void GLAPIENTRY glLightfv( GLenum light, GLenum pname,
+ const GLfloat *params );
+GLAPI void GLAPIENTRY glLightiv( GLenum light, GLenum pname,
+ const GLint *params );
+GLAPI void GLAPIENTRY glGetLightfv( GLenum light, GLenum pname,
+ GLfloat *params );
+GLAPI void GLAPIENTRY glGetLightiv( GLenum light, GLenum pname,
+ GLint *params );
+GLAPI void GLAPIENTRY glLightModelf( GLenum pname, GLfloat param );
+GLAPI void GLAPIENTRY glLightModeli( GLenum pname, GLint param );
+GLAPI void GLAPIENTRY glLightModelfv( GLenum pname, const GLfloat *params );
+GLAPI void GLAPIENTRY glLightModeliv( GLenum pname, const GLint *params );
+GLAPI void GLAPIENTRY glMaterialf( GLenum face, GLenum pname, GLfloat param );
+GLAPI void GLAPIENTRY glMateriali( GLenum face, GLenum pname, GLint param );
+GLAPI void GLAPIENTRY glMaterialfv( GLenum face, GLenum pname, const GLfloat *params );
+GLAPI void GLAPIENTRY glMaterialiv( GLenum face, GLenum pname, const GLint *params );
+GLAPI void GLAPIENTRY glGetMaterialfv( GLenum face, GLenum pname, GLfloat *params );
+GLAPI void GLAPIENTRY glGetMaterialiv( GLenum face, GLenum pname, GLint *params );
+GLAPI void GLAPIENTRY glColorMaterial( GLenum face, GLenum mode );
+ * Raster functions
+ */
+GLAPI void GLAPIENTRY glPixelZoom( GLfloat xfactor, GLfloat yfactor );
+GLAPI void GLAPIENTRY glPixelStoref( GLenum pname, GLfloat param );
+GLAPI void GLAPIENTRY glPixelStorei( GLenum pname, GLint param );
+GLAPI void GLAPIENTRY glPixelTransferf( GLenum pname, GLfloat param );
+GLAPI void GLAPIENTRY glPixelTransferi( GLenum pname, GLint param );
+GLAPI void GLAPIENTRY glPixelMapfv( GLenum map, GLsizei mapsize,
+ const GLfloat *values );
+GLAPI void GLAPIENTRY glPixelMapuiv( GLenum map, GLsizei mapsize,
+ const GLuint *values );
+GLAPI void GLAPIENTRY glPixelMapusv( GLenum map, GLsizei mapsize,
+ const GLushort *values );
+GLAPI void GLAPIENTRY glGetPixelMapfv( GLenum map, GLfloat *values );
+GLAPI void GLAPIENTRY glGetPixelMapuiv( GLenum map, GLuint *values );
+GLAPI void GLAPIENTRY glGetPixelMapusv( GLenum map, GLushort *values );
+GLAPI void GLAPIENTRY glBitmap( GLsizei width, GLsizei height,
+ GLfloat xorig, GLfloat yorig,
+ GLfloat xmove, GLfloat ymove,
+ const GLubyte *bitmap );
+GLAPI void GLAPIENTRY glReadPixels( GLint x, GLint y,
+ GLsizei width, GLsizei height,
+ GLenum format, GLenum type,
+ GLvoid *pixels );
+GLAPI void GLAPIENTRY glDrawPixels( GLsizei width, GLsizei height,
+ GLenum format, GLenum type,
+ const GLvoid *pixels );
+GLAPI void GLAPIENTRY glCopyPixels( GLint x, GLint y,
+ GLsizei width, GLsizei height,
+ GLenum type );
+ * Stenciling
+ */
+GLAPI void GLAPIENTRY glStencilFunc( GLenum func, GLint ref, GLuint mask );
+GLAPI void GLAPIENTRY glStencilMask( GLuint mask );
+GLAPI void GLAPIENTRY glStencilOp( GLenum fail, GLenum zfail, GLenum zpass );
+GLAPI void GLAPIENTRY glClearStencil( GLint s );
+ * Texture mapping
+ */
+GLAPI void GLAPIENTRY glTexGend( GLenum coord, GLenum pname, GLdouble param );
+GLAPI void GLAPIENTRY glTexGenf( GLenum coord, GLenum pname, GLfloat param );
+GLAPI void GLAPIENTRY glTexGeni( GLenum coord, GLenum pname, GLint param );
+GLAPI void GLAPIENTRY glTexGendv( GLenum coord, GLenum pname, const GLdouble *params );
+GLAPI void GLAPIENTRY glTexGenfv( GLenum coord, GLenum pname, const GLfloat *params );
+GLAPI void GLAPIENTRY glTexGeniv( GLenum coord, GLenum pname, const GLint *params );
+GLAPI void GLAPIENTRY glGetTexGendv( GLenum coord, GLenum pname, GLdouble *params );
+GLAPI void GLAPIENTRY glGetTexGenfv( GLenum coord, GLenum pname, GLfloat *params );
+GLAPI void GLAPIENTRY glGetTexGeniv( GLenum coord, GLenum pname, GLint *params );
+GLAPI void GLAPIENTRY glTexEnvf( GLenum target, GLenum pname, GLfloat param );
+GLAPI void GLAPIENTRY glTexEnvi( GLenum target, GLenum pname, GLint param );
+GLAPI void GLAPIENTRY glTexEnvfv( GLenum target, GLenum pname, const GLfloat *params );
+GLAPI void GLAPIENTRY glTexEnviv( GLenum target, GLenum pname, const GLint *params );
+GLAPI void GLAPIENTRY glGetTexEnvfv( GLenum target, GLenum pname, GLfloat *params );
+GLAPI void GLAPIENTRY glGetTexEnviv( GLenum target, GLenum pname, GLint *params );
+GLAPI void GLAPIENTRY glTexParameterf( GLenum target, GLenum pname, GLfloat param );
+GLAPI void GLAPIENTRY glTexParameteri( GLenum target, GLenum pname, GLint param );
+GLAPI void GLAPIENTRY glTexParameterfv( GLenum target, GLenum pname,
+ const GLfloat *params );
+GLAPI void GLAPIENTRY glTexParameteriv( GLenum target, GLenum pname,
+ const GLint *params );
+GLAPI void GLAPIENTRY glGetTexParameterfv( GLenum target,
+ GLenum pname, GLfloat *params);
+GLAPI void GLAPIENTRY glGetTexParameteriv( GLenum target,
+ GLenum pname, GLint *params );
+GLAPI void GLAPIENTRY glGetTexLevelParameterfv( GLenum target, GLint level,
+ GLenum pname, GLfloat *params );
+GLAPI void GLAPIENTRY glGetTexLevelParameteriv( GLenum target, GLint level,
+ GLenum pname, GLint *params );
+GLAPI void GLAPIENTRY glTexImage1D( GLenum target, GLint level,
+ GLint internalFormat,
+ GLsizei width, GLint border,
+ GLenum format, GLenum type,
+ const GLvoid *pixels );
+GLAPI void GLAPIENTRY glTexImage2D( GLenum target, GLint level,
+ GLint internalFormat,
+ GLsizei width, GLsizei height,
+ GLint border, GLenum format, GLenum type,
+ const GLvoid *pixels );
+GLAPI void GLAPIENTRY glGetTexImage( GLenum target, GLint level,
+ GLenum format, GLenum type,
+ GLvoid *pixels );
+/* 1.1 functions */
+GLAPI void GLAPIENTRY glGenTextures( GLsizei n, GLuint *textures );
+GLAPI void GLAPIENTRY glDeleteTextures( GLsizei n, const GLuint *textures);
+GLAPI void GLAPIENTRY glBindTexture( GLenum target, GLuint texture );
+GLAPI void GLAPIENTRY glPrioritizeTextures( GLsizei n,
+ const GLuint *textures,
+ const GLclampf *priorities );
+GLAPI GLboolean GLAPIENTRY glAreTexturesResident( GLsizei n,
+ const GLuint *textures,
+ GLboolean *residences );
+GLAPI GLboolean GLAPIENTRY glIsTexture( GLuint texture );
+GLAPI void GLAPIENTRY glTexSubImage1D( GLenum target, GLint level,
+ GLint xoffset,
+ GLsizei width, GLenum format,
+ GLenum type, const GLvoid *pixels );
+GLAPI void GLAPIENTRY glTexSubImage2D( GLenum target, GLint level,
+ GLint xoffset, GLint yoffset,
+ GLsizei width, GLsizei height,
+ GLenum format, GLenum type,
+ const GLvoid *pixels );
+GLAPI void GLAPIENTRY glCopyTexImage1D( GLenum target, GLint level,
+ GLenum internalformat,
+ GLint x, GLint y,
+ GLsizei width, GLint border );
+GLAPI void GLAPIENTRY glCopyTexImage2D( GLenum target, GLint level,
+ GLenum internalformat,
+ GLint x, GLint y,
+ GLsizei width, GLsizei height,
+ GLint border );
+GLAPI void GLAPIENTRY glCopyTexSubImage1D( GLenum target, GLint level,
+ GLint xoffset, GLint x, GLint y,
+ GLsizei width );
+GLAPI void GLAPIENTRY glCopyTexSubImage2D( GLenum target, GLint level,
+ GLint xoffset, GLint yoffset,
+ GLint x, GLint y,
+ GLsizei width, GLsizei height );
+ * Evaluators
+ */
+GLAPI void GLAPIENTRY glMap1d( GLenum target, GLdouble u1, GLdouble u2,
+ GLint stride,
+ GLint order, const GLdouble *points );
+GLAPI void GLAPIENTRY glMap1f( GLenum target, GLfloat u1, GLfloat u2,
+ GLint stride,
+ GLint order, const GLfloat *points );
+GLAPI void GLAPIENTRY glMap2d( GLenum target,
+ GLdouble u1, GLdouble u2, GLint ustride, GLint uorder,
+ GLdouble v1, GLdouble v2, GLint vstride, GLint vorder,
+ const GLdouble *points );
+GLAPI void GLAPIENTRY glMap2f( GLenum target,
+ GLfloat u1, GLfloat u2, GLint ustride, GLint uorder,
+ GLfloat v1, GLfloat v2, GLint vstride, GLint vorder,
+ const GLfloat *points );
+GLAPI void GLAPIENTRY glGetMapdv( GLenum target, GLenum query, GLdouble *v );
+GLAPI void GLAPIENTRY glGetMapfv( GLenum target, GLenum query, GLfloat *v );
+GLAPI void GLAPIENTRY glGetMapiv( GLenum target, GLenum query, GLint *v );
+GLAPI void GLAPIENTRY glEvalCoord1d( GLdouble u );
+GLAPI void GLAPIENTRY glEvalCoord1f( GLfloat u );
+GLAPI void GLAPIENTRY glEvalCoord1dv( const GLdouble *u );
+GLAPI void GLAPIENTRY glEvalCoord1fv( const GLfloat *u );
+GLAPI void GLAPIENTRY glEvalCoord2d( GLdouble u, GLdouble v );
+GLAPI void GLAPIENTRY glEvalCoord2f( GLfloat u, GLfloat v );
+GLAPI void GLAPIENTRY glEvalCoord2dv( const GLdouble *u );
+GLAPI void GLAPIENTRY glEvalCoord2fv( const GLfloat *u );
+GLAPI void GLAPIENTRY glMapGrid1d( GLint un, GLdouble u1, GLdouble u2 );
+GLAPI void GLAPIENTRY glMapGrid1f( GLint un, GLfloat u1, GLfloat u2 );
+GLAPI void GLAPIENTRY glMapGrid2d( GLint un, GLdouble u1, GLdouble u2,
+ GLint vn, GLdouble v1, GLdouble v2 );
+GLAPI void GLAPIENTRY glMapGrid2f( GLint un, GLfloat u1, GLfloat u2,
+ GLint vn, GLfloat v1, GLfloat v2 );
+GLAPI void GLAPIENTRY glEvalPoint1( GLint i );
+GLAPI void GLAPIENTRY glEvalPoint2( GLint i, GLint j );
+GLAPI void GLAPIENTRY glEvalMesh1( GLenum mode, GLint i1, GLint i2 );
+GLAPI void GLAPIENTRY glEvalMesh2( GLenum mode, GLint i1, GLint i2, GLint j1, GLint j2 );
+ * Fog
+ */
+GLAPI void GLAPIENTRY glFogf( GLenum pname, GLfloat param );
+GLAPI void GLAPIENTRY glFogi( GLenum pname, GLint param );
+GLAPI void GLAPIENTRY glFogfv( GLenum pname, const GLfloat *params );
+GLAPI void GLAPIENTRY glFogiv( GLenum pname, const GLint *params );
+ * Selection and Feedback
+ */
+GLAPI void GLAPIENTRY glFeedbackBuffer( GLsizei size, GLenum type, GLfloat *buffer );
+GLAPI void GLAPIENTRY glPassThrough( GLfloat token );
+GLAPI void GLAPIENTRY glSelectBuffer( GLsizei size, GLuint *buffer );
+GLAPI void GLAPIENTRY glInitNames( void );
+GLAPI void GLAPIENTRY glLoadName( GLuint name );
+GLAPI void GLAPIENTRY glPushName( GLuint name );
+GLAPI void GLAPIENTRY glPopName( void );
+ * OpenGL 1.2
+ */
+#define GL_RESCALE_NORMAL 0x803A
+#define GL_CLAMP_TO_EDGE 0x812F
+#define GL_BGR 0x80E0
+#define GL_BGRA 0x80E1
+#define GL_UNSIGNED_BYTE_3_3_2 0x8032
+#define GL_UNSIGNED_BYTE_2_3_3_REV 0x8362
+#define GL_UNSIGNED_SHORT_5_6_5 0x8363
+#define GL_UNSIGNED_SHORT_5_6_5_REV 0x8364
+#define GL_UNSIGNED_SHORT_4_4_4_4 0x8033
+#define GL_UNSIGNED_SHORT_4_4_4_4_REV 0x8365
+#define GL_UNSIGNED_SHORT_5_5_5_1 0x8034
+#define GL_UNSIGNED_SHORT_1_5_5_5_REV 0x8366
+#define GL_UNSIGNED_INT_8_8_8_8 0x8035
+#define GL_UNSIGNED_INT_8_8_8_8_REV 0x8367
+#define GL_UNSIGNED_INT_10_10_10_2 0x8036
+#define GL_UNSIGNED_INT_2_10_10_10_REV 0x8368
+#define GL_SINGLE_COLOR 0x81F9
+#define GL_TEXTURE_MIN_LOD 0x813A
+#define GL_TEXTURE_MAX_LOD 0x813B
+#define GL_TEXTURE_MAX_LEVEL 0x813D
+#define GL_PACK_SKIP_IMAGES 0x806B
+#define GL_PACK_IMAGE_HEIGHT 0x806C
+#define GL_TEXTURE_3D 0x806F
+#define GL_PROXY_TEXTURE_3D 0x8070
+#define GL_TEXTURE_DEPTH 0x8071
+#define GL_TEXTURE_WRAP_R 0x8072
+#define GL_MAX_3D_TEXTURE_SIZE 0x8073
+#define GL_TEXTURE_BINDING_3D 0x806A
+GLAPI void GLAPIENTRY glDrawRangeElements( GLenum mode, GLuint start,
+ GLuint end, GLsizei count, GLenum type, const GLvoid *indices );
+GLAPI void GLAPIENTRY glTexImage3D( GLenum target, GLint level,
+ GLint internalFormat,
+ GLsizei width, GLsizei height,
+ GLsizei depth, GLint border,
+ GLenum format, GLenum type,
+ const GLvoid *pixels );
+GLAPI void GLAPIENTRY glTexSubImage3D( GLenum target, GLint level,
+ GLint xoffset, GLint yoffset,
+ GLint zoffset, GLsizei width,
+ GLsizei height, GLsizei depth,
+ GLenum format,
+ GLenum type, const GLvoid *pixels);
+GLAPI void GLAPIENTRY glCopyTexSubImage3D( GLenum target, GLint level,
+ GLint xoffset, GLint yoffset,
+ GLint zoffset, GLint x,
+ GLint y, GLsizei width,
+ GLsizei height );
+typedef void (APIENTRYP PFNGLDRAWRANGEELEMENTSPROC) (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, const GLvoid *indices);
+typedef void (APIENTRYP PFNGLTEXIMAGE3DPROC) (GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const GLvoid *pixels);
+typedef void (APIENTRYP PFNGLTEXSUBIMAGE3DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const GLvoid *pixels);
+typedef void (APIENTRYP PFNGLCOPYTEXSUBIMAGE3DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint x, GLint y, GLsizei width, GLsizei height);
+ * GL_ARB_imaging
+ */
+#define GL_CONSTANT_COLOR 0x8001
+#define GL_CONSTANT_ALPHA 0x8003
+#define GL_COLOR_TABLE 0x80D0
+#define GL_PROXY_COLOR_TABLE 0x80D3
+#define GL_COLOR_TABLE_SCALE 0x80D6
+#define GL_COLOR_TABLE_BIAS 0x80D7
+#define GL_COLOR_TABLE_WIDTH 0x80D9
+#define GL_CONVOLUTION_1D 0x8010
+#define GL_CONVOLUTION_2D 0x8011
+#define GL_SEPARABLE_2D 0x8012
+#define GL_REDUCE 0x8016
+#define GL_CONVOLUTION_WIDTH 0x8018
+#define GL_CONSTANT_BORDER 0x8151
+#define GL_REPLICATE_BORDER 0x8153
+#define GL_COLOR_MATRIX 0x80B1
+#define GL_HISTOGRAM 0x8024
+#define GL_PROXY_HISTOGRAM 0x8025
+#define GL_HISTOGRAM_WIDTH 0x8026
+#define GL_HISTOGRAM_FORMAT 0x8027
+#define GL_HISTOGRAM_RED_SIZE 0x8028
+#define GL_HISTOGRAM_SINK 0x802D
+#define GL_MINMAX 0x802E
+#define GL_MINMAX_FORMAT 0x802F
+#define GL_MINMAX_SINK 0x8030
+#define GL_TABLE_TOO_LARGE 0x8031
+#define GL_BLEND_EQUATION 0x8009
+#define GL_MIN 0x8007
+#define GL_MAX 0x8008
+#define GL_FUNC_ADD 0x8006
+#define GL_FUNC_SUBTRACT 0x800A
+#define GL_BLEND_COLOR 0x8005
+GLAPI void GLAPIENTRY glColorTable( GLenum target, GLenum internalformat,
+ GLsizei width, GLenum format,
+ GLenum type, const GLvoid *table );
+GLAPI void GLAPIENTRY glColorSubTable( GLenum target,
+ GLsizei start, GLsizei count,
+ GLenum format, GLenum type,
+ const GLvoid *data );
+GLAPI void GLAPIENTRY glColorTableParameteriv(GLenum target, GLenum pname,
+ const GLint *params);
+GLAPI void GLAPIENTRY glColorTableParameterfv(GLenum target, GLenum pname,
+ const GLfloat *params);
+GLAPI void GLAPIENTRY glCopyColorSubTable( GLenum target, GLsizei start,
+ GLint x, GLint y, GLsizei width );
+GLAPI void GLAPIENTRY glCopyColorTable( GLenum target, GLenum internalformat,
+ GLint x, GLint y, GLsizei width );
+GLAPI void GLAPIENTRY glGetColorTable( GLenum target, GLenum format,
+ GLenum type, GLvoid *table );
+GLAPI void GLAPIENTRY glGetColorTableParameterfv( GLenum target, GLenum pname,
+ GLfloat *params );
+GLAPI void GLAPIENTRY glGetColorTableParameteriv( GLenum target, GLenum pname,
+ GLint *params );
+GLAPI void GLAPIENTRY glBlendEquation( GLenum mode );
+GLAPI void GLAPIENTRY glBlendColor( GLclampf red, GLclampf green,
+ GLclampf blue, GLclampf alpha );
+GLAPI void GLAPIENTRY glHistogram( GLenum target, GLsizei width,
+ GLenum internalformat, GLboolean sink );
+GLAPI void GLAPIENTRY glResetHistogram( GLenum target );
+GLAPI void GLAPIENTRY glGetHistogram( GLenum target, GLboolean reset,
+ GLenum format, GLenum type,
+ GLvoid *values );
+GLAPI void GLAPIENTRY glGetHistogramParameterfv( GLenum target, GLenum pname,
+ GLfloat *params );
+GLAPI void GLAPIENTRY glGetHistogramParameteriv( GLenum target, GLenum pname,
+ GLint *params );
+GLAPI void GLAPIENTRY glMinmax( GLenum target, GLenum internalformat,
+ GLboolean sink );
+GLAPI void GLAPIENTRY glResetMinmax( GLenum target );
+GLAPI void GLAPIENTRY glGetMinmax( GLenum target, GLboolean reset,
+ GLenum format, GLenum types,
+ GLvoid *values );
+GLAPI void GLAPIENTRY glGetMinmaxParameterfv( GLenum target, GLenum pname,
+ GLfloat *params );
+GLAPI void GLAPIENTRY glGetMinmaxParameteriv( GLenum target, GLenum pname,
+ GLint *params );
+GLAPI void GLAPIENTRY glConvolutionFilter1D( GLenum target,
+ GLenum internalformat, GLsizei width, GLenum format, GLenum type,
+ const GLvoid *image );
+GLAPI void GLAPIENTRY glConvolutionFilter2D( GLenum target,
+ GLenum internalformat, GLsizei width, GLsizei height, GLenum format,
+ GLenum type, const GLvoid *image );
+GLAPI void GLAPIENTRY glConvolutionParameterf( GLenum target, GLenum pname,
+ GLfloat params );
+GLAPI void GLAPIENTRY glConvolutionParameterfv( GLenum target, GLenum pname,
+ const GLfloat *params );
+GLAPI void GLAPIENTRY glConvolutionParameteri( GLenum target, GLenum pname,
+ GLint params );
+GLAPI void GLAPIENTRY glConvolutionParameteriv( GLenum target, GLenum pname,
+ const GLint *params );
+GLAPI void GLAPIENTRY glCopyConvolutionFilter1D( GLenum target,
+ GLenum internalformat, GLint x, GLint y, GLsizei width );
+GLAPI void GLAPIENTRY glCopyConvolutionFilter2D( GLenum target,
+ GLenum internalformat, GLint x, GLint y, GLsizei width,
+ GLsizei height);
+GLAPI void GLAPIENTRY glGetConvolutionFilter( GLenum target, GLenum format,
+ GLenum type, GLvoid *image );
+GLAPI void GLAPIENTRY glGetConvolutionParameterfv( GLenum target, GLenum pname,
+ GLfloat *params );
+GLAPI void GLAPIENTRY glGetConvolutionParameteriv( GLenum target, GLenum pname,
+ GLint *params );
+GLAPI void GLAPIENTRY glSeparableFilter2D( GLenum target,
+ GLenum internalformat, GLsizei width, GLsizei height, GLenum format,
+ GLenum type, const GLvoid *row, const GLvoid *column );
+GLAPI void GLAPIENTRY glGetSeparableFilter( GLenum target, GLenum format,
+ GLenum type, GLvoid *row, GLvoid *column, GLvoid *span );
+typedef void (APIENTRYP PFNGLBLENDCOLORPROC) (GLclampf red, GLclampf green, GLclampf blue, GLclampf alpha);
+typedef void (APIENTRYP PFNGLCOLORTABLEPROC) (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const GLvoid *table);
+typedef void (APIENTRYP PFNGLCOLORTABLEPARAMETERFVPROC) (GLenum target, GLenum pname, const GLfloat *params);
+typedef void (APIENTRYP PFNGLCOLORTABLEPARAMETERIVPROC) (GLenum target, GLenum pname, const GLint *params);
+typedef void (APIENTRYP PFNGLCOPYCOLORTABLEPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width);
+typedef void (APIENTRYP PFNGLGETCOLORTABLEPROC) (GLenum target, GLenum format, GLenum type, GLvoid *table);
+typedef void (APIENTRYP PFNGLGETCOLORTABLEPARAMETERFVPROC) (GLenum target, GLenum pname, GLfloat *params);
+typedef void (APIENTRYP PFNGLGETCOLORTABLEPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params);
+typedef void (APIENTRYP PFNGLCOLORSUBTABLEPROC) (GLenum target, GLsizei start, GLsizei count, GLenum format, GLenum type, const GLvoid *data);
+typedef void (APIENTRYP PFNGLCOPYCOLORSUBTABLEPROC) (GLenum target, GLsizei start, GLint x, GLint y, GLsizei width);
+typedef void (APIENTRYP PFNGLCONVOLUTIONFILTER1DPROC) (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const GLvoid *image);
+typedef void (APIENTRYP PFNGLCONVOLUTIONFILTER2DPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *image);
+typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERFPROC) (GLenum target, GLenum pname, GLfloat params);
+typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERFVPROC) (GLenum target, GLenum pname, const GLfloat *params);
+typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERIPROC) (GLenum target, GLenum pname, GLint params);
+typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERIVPROC) (GLenum target, GLenum pname, const GLint *params);
+typedef void (APIENTRYP PFNGLCOPYCONVOLUTIONFILTER1DPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width);
+typedef void (APIENTRYP PFNGLCOPYCONVOLUTIONFILTER2DPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height);
+typedef void (APIENTRYP PFNGLGETCONVOLUTIONFILTERPROC) (GLenum target, GLenum format, GLenum type, GLvoid *image);
+typedef void (APIENTRYP PFNGLGETCONVOLUTIONPARAMETERFVPROC) (GLenum target, GLenum pname, GLfloat *params);
+typedef void (APIENTRYP PFNGLGETCONVOLUTIONPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params);
+typedef void (APIENTRYP PFNGLGETSEPARABLEFILTERPROC) (GLenum target, GLenum format, GLenum type, GLvoid *row, GLvoid *column, GLvoid *span);
+typedef void (APIENTRYP PFNGLSEPARABLEFILTER2DPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *row, const GLvoid *column);
+typedef void (APIENTRYP PFNGLGETHISTOGRAMPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, GLvoid *values);
+typedef void (APIENTRYP PFNGLGETHISTOGRAMPARAMETERFVPROC) (GLenum target, GLenum pname, GLfloat *params);
+typedef void (APIENTRYP PFNGLGETHISTOGRAMPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params);
+typedef void (APIENTRYP PFNGLGETMINMAXPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, GLvoid *values);
+typedef void (APIENTRYP PFNGLGETMINMAXPARAMETERFVPROC) (GLenum target, GLenum pname, GLfloat *params);
+typedef void (APIENTRYP PFNGLGETMINMAXPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params);
+typedef void (APIENTRYP PFNGLHISTOGRAMPROC) (GLenum target, GLsizei width, GLenum internalformat, GLboolean sink);
+typedef void (APIENTRYP PFNGLMINMAXPROC) (GLenum target, GLenum internalformat, GLboolean sink);
+typedef void (APIENTRYP PFNGLRESETMINMAXPROC) (GLenum target);
+ * OpenGL 1.3
+ */
+/* multitexture */
+#define GL_TEXTURE0 0x84C0
+#define GL_TEXTURE1 0x84C1
+#define GL_TEXTURE2 0x84C2
+#define GL_TEXTURE3 0x84C3
+#define GL_TEXTURE4 0x84C4
+#define GL_TEXTURE5 0x84C5
+#define GL_TEXTURE6 0x84C6
+#define GL_TEXTURE7 0x84C7
+#define GL_TEXTURE8 0x84C8
+#define GL_TEXTURE9 0x84C9
+#define GL_TEXTURE10 0x84CA
+#define GL_TEXTURE11 0x84CB
+#define GL_TEXTURE12 0x84CC
+#define GL_TEXTURE13 0x84CD
+#define GL_TEXTURE14 0x84CE
+#define GL_TEXTURE15 0x84CF
+#define GL_TEXTURE16 0x84D0
+#define GL_TEXTURE17 0x84D1
+#define GL_TEXTURE18 0x84D2
+#define GL_TEXTURE19 0x84D3
+#define GL_TEXTURE20 0x84D4
+#define GL_TEXTURE21 0x84D5
+#define GL_TEXTURE22 0x84D6
+#define GL_TEXTURE23 0x84D7
+#define GL_TEXTURE24 0x84D8
+#define GL_TEXTURE25 0x84D9
+#define GL_TEXTURE26 0x84DA
+#define GL_TEXTURE27 0x84DB
+#define GL_TEXTURE28 0x84DC
+#define GL_TEXTURE29 0x84DD
+#define GL_TEXTURE30 0x84DE
+#define GL_TEXTURE31 0x84DF
+#define GL_ACTIVE_TEXTURE 0x84E0
+#define GL_MAX_TEXTURE_UNITS 0x84E2
+/* texture_cube_map */
+#define GL_NORMAL_MAP 0x8511
+#define GL_REFLECTION_MAP 0x8512
+#define GL_TEXTURE_CUBE_MAP 0x8513
+/* texture_compression */
+/* multisample */
+#define GL_MULTISAMPLE 0x809D
+#define GL_SAMPLE_ALPHA_TO_ONE 0x809F
+#define GL_SAMPLE_COVERAGE 0x80A0
+#define GL_SAMPLE_BUFFERS 0x80A8
+#define GL_SAMPLES 0x80A9
+#define GL_MULTISAMPLE_BIT 0x20000000
+/* transpose_matrix */
+/* texture_env_combine */
+#define GL_COMBINE 0x8570
+#define GL_COMBINE_RGB 0x8571
+#define GL_COMBINE_ALPHA 0x8572
+#define GL_SOURCE0_RGB 0x8580
+#define GL_SOURCE1_RGB 0x8581
+#define GL_SOURCE2_RGB 0x8582
+#define GL_SOURCE0_ALPHA 0x8588
+#define GL_SOURCE1_ALPHA 0x8589
+#define GL_SOURCE2_ALPHA 0x858A
+#define GL_OPERAND0_RGB 0x8590
+#define GL_OPERAND1_RGB 0x8591
+#define GL_OPERAND2_RGB 0x8592
+#define GL_OPERAND0_ALPHA 0x8598
+#define GL_OPERAND1_ALPHA 0x8599
+#define GL_OPERAND2_ALPHA 0x859A
+#define GL_RGB_SCALE 0x8573
+#define GL_ADD_SIGNED 0x8574
+#define GL_INTERPOLATE 0x8575
+#define GL_SUBTRACT 0x84E7
+#define GL_CONSTANT 0x8576
+#define GL_PRIMARY_COLOR 0x8577
+#define GL_PREVIOUS 0x8578
+/* texture_env_dot3 */
+#define GL_DOT3_RGB 0x86AE
+#define GL_DOT3_RGBA 0x86AF
+/* texture_border_clamp */
+#define GL_CLAMP_TO_BORDER 0x812D
+GLAPI void GLAPIENTRY glActiveTexture( GLenum texture );
+GLAPI void GLAPIENTRY glClientActiveTexture( GLenum texture );
+GLAPI void GLAPIENTRY glCompressedTexImage1D( GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const GLvoid *data );
+GLAPI void GLAPIENTRY glCompressedTexImage2D( GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const GLvoid *data );
+GLAPI void GLAPIENTRY glCompressedTexImage3D( GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const GLvoid *data );
+GLAPI void GLAPIENTRY glCompressedTexSubImage1D( GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const GLvoid *data );
+GLAPI void GLAPIENTRY glCompressedTexSubImage2D( GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const GLvoid *data );
+GLAPI void GLAPIENTRY glCompressedTexSubImage3D( GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const GLvoid *data );
+GLAPI void GLAPIENTRY glGetCompressedTexImage( GLenum target, GLint lod, GLvoid *img );
+GLAPI void GLAPIENTRY glMultiTexCoord1d( GLenum target, GLdouble s );
+GLAPI void GLAPIENTRY glMultiTexCoord1dv( GLenum target, const GLdouble *v );
+GLAPI void GLAPIENTRY glMultiTexCoord1f( GLenum target, GLfloat s );
+GLAPI void GLAPIENTRY glMultiTexCoord1fv( GLenum target, const GLfloat *v );
+GLAPI void GLAPIENTRY glMultiTexCoord1i( GLenum target, GLint s );
+GLAPI void GLAPIENTRY glMultiTexCoord1iv( GLenum target, const GLint *v );
+GLAPI void GLAPIENTRY glMultiTexCoord1s( GLenum target, GLshort s );
+GLAPI void GLAPIENTRY glMultiTexCoord1sv( GLenum target, const GLshort *v );
+GLAPI void GLAPIENTRY glMultiTexCoord2d( GLenum target, GLdouble s, GLdouble t );
+GLAPI void GLAPIENTRY glMultiTexCoord2dv( GLenum target, const GLdouble *v );
+GLAPI void GLAPIENTRY glMultiTexCoord2f( GLenum target, GLfloat s, GLfloat t );
+GLAPI void GLAPIENTRY glMultiTexCoord2fv( GLenum target, const GLfloat *v );
+GLAPI void GLAPIENTRY glMultiTexCoord2i( GLenum target, GLint s, GLint t );
+GLAPI void GLAPIENTRY glMultiTexCoord2iv( GLenum target, const GLint *v );
+GLAPI void GLAPIENTRY glMultiTexCoord2s( GLenum target, GLshort s, GLshort t );
+GLAPI void GLAPIENTRY glMultiTexCoord2sv( GLenum target, const GLshort *v );
+GLAPI void GLAPIENTRY glMultiTexCoord3d( GLenum target, GLdouble s, GLdouble t, GLdouble r );
+GLAPI void GLAPIENTRY glMultiTexCoord3dv( GLenum target, const GLdouble *v );
+GLAPI void GLAPIENTRY glMultiTexCoord3f( GLenum target, GLfloat s, GLfloat t, GLfloat r );
+GLAPI void GLAPIENTRY glMultiTexCoord3fv( GLenum target, const GLfloat *v );
+GLAPI void GLAPIENTRY glMultiTexCoord3i( GLenum target, GLint s, GLint t, GLint r );
+GLAPI void GLAPIENTRY glMultiTexCoord3iv( GLenum target, const GLint *v );
+GLAPI void GLAPIENTRY glMultiTexCoord3s( GLenum target, GLshort s, GLshort t, GLshort r );
+GLAPI void GLAPIENTRY glMultiTexCoord3sv( GLenum target, const GLshort *v );
+GLAPI void GLAPIENTRY glMultiTexCoord4d( GLenum target, GLdouble s, GLdouble t, GLdouble r, GLdouble q );
+GLAPI void GLAPIENTRY glMultiTexCoord4dv( GLenum target, const GLdouble *v );
+GLAPI void GLAPIENTRY glMultiTexCoord4f( GLenum target, GLfloat s, GLfloat t, GLfloat r, GLfloat q );
+GLAPI void GLAPIENTRY glMultiTexCoord4fv( GLenum target, const GLfloat *v );
+GLAPI void GLAPIENTRY glMultiTexCoord4i( GLenum target, GLint s, GLint t, GLint r, GLint q );
+GLAPI void GLAPIENTRY glMultiTexCoord4iv( GLenum target, const GLint *v );
+GLAPI void GLAPIENTRY glMultiTexCoord4s( GLenum target, GLshort s, GLshort t, GLshort r, GLshort q );
+GLAPI void GLAPIENTRY glMultiTexCoord4sv( GLenum target, const GLshort *v );
+GLAPI void GLAPIENTRY glLoadTransposeMatrixd( const GLdouble m[16] );
+GLAPI void GLAPIENTRY glLoadTransposeMatrixf( const GLfloat m[16] );
+GLAPI void GLAPIENTRY glMultTransposeMatrixd( const GLdouble m[16] );
+GLAPI void GLAPIENTRY glMultTransposeMatrixf( const GLfloat m[16] );
+GLAPI void GLAPIENTRY glSampleCoverage( GLclampf value, GLboolean invert );
+typedef void (APIENTRYP PFNGLACTIVETEXTUREPROC) (GLenum texture);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD1DPROC) (GLenum target, GLdouble s);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD1DVPROC) (GLenum target, const GLdouble *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD1FPROC) (GLenum target, GLfloat s);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD1FVPROC) (GLenum target, const GLfloat *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD1IPROC) (GLenum target, GLint s);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD1IVPROC) (GLenum target, const GLint *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD1SPROC) (GLenum target, GLshort s);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD1SVPROC) (GLenum target, const GLshort *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD2DPROC) (GLenum target, GLdouble s, GLdouble t);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD2DVPROC) (GLenum target, const GLdouble *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD2FPROC) (GLenum target, GLfloat s, GLfloat t);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD2FVPROC) (GLenum target, const GLfloat *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD2IPROC) (GLenum target, GLint s, GLint t);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD2IVPROC) (GLenum target, const GLint *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD2SPROC) (GLenum target, GLshort s, GLshort t);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD2SVPROC) (GLenum target, const GLshort *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD3DPROC) (GLenum target, GLdouble s, GLdouble t, GLdouble r);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD3DVPROC) (GLenum target, const GLdouble *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD3FPROC) (GLenum target, GLfloat s, GLfloat t, GLfloat r);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD3FVPROC) (GLenum target, const GLfloat *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD3IPROC) (GLenum target, GLint s, GLint t, GLint r);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD3IVPROC) (GLenum target, const GLint *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD3SPROC) (GLenum target, GLshort s, GLshort t, GLshort r);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD3SVPROC) (GLenum target, const GLshort *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD4DPROC) (GLenum target, GLdouble s, GLdouble t, GLdouble r, GLdouble q);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD4DVPROC) (GLenum target, const GLdouble *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD4FPROC) (GLenum target, GLfloat s, GLfloat t, GLfloat r, GLfloat q);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD4FVPROC) (GLenum target, const GLfloat *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD4IPROC) (GLenum target, GLint s, GLint t, GLint r, GLint q);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD4IVPROC) (GLenum target, const GLint *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD4SPROC) (GLenum target, GLshort s, GLshort t, GLshort r, GLshort q);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD4SVPROC) (GLenum target, const GLshort *v);
+typedef void (APIENTRYP PFNGLSAMPLECOVERAGEPROC) (GLclampf value, GLboolean invert);
+typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE3DPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const GLvoid *data);
+typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE2DPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const GLvoid *data);
+typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE1DPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const GLvoid *data);
+typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE3DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const GLvoid *data);
+typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE2DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const GLvoid *data);
+typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE1DPROC) (GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const GLvoid *data);
+typedef void (APIENTRYP PFNGLGETCOMPRESSEDTEXIMAGEPROC) (GLenum target, GLint level, void *img);
+ * GL_ARB_multitexture (ARB extension 1 and OpenGL 1.2.1)
+ */
+#ifndef GL_ARB_multitexture
+#define GL_ARB_multitexture 1
+#define GL_TEXTURE0_ARB 0x84C0
+#define GL_TEXTURE1_ARB 0x84C1
+#define GL_TEXTURE2_ARB 0x84C2
+#define GL_TEXTURE3_ARB 0x84C3
+#define GL_TEXTURE4_ARB 0x84C4
+#define GL_TEXTURE5_ARB 0x84C5
+#define GL_TEXTURE6_ARB 0x84C6
+#define GL_TEXTURE7_ARB 0x84C7
+#define GL_TEXTURE8_ARB 0x84C8
+#define GL_TEXTURE9_ARB 0x84C9
+#define GL_TEXTURE10_ARB 0x84CA
+#define GL_TEXTURE11_ARB 0x84CB
+#define GL_TEXTURE12_ARB 0x84CC
+#define GL_TEXTURE13_ARB 0x84CD
+#define GL_TEXTURE14_ARB 0x84CE
+#define GL_TEXTURE15_ARB 0x84CF
+#define GL_TEXTURE16_ARB 0x84D0
+#define GL_TEXTURE17_ARB 0x84D1
+#define GL_TEXTURE18_ARB 0x84D2
+#define GL_TEXTURE19_ARB 0x84D3
+#define GL_TEXTURE20_ARB 0x84D4
+#define GL_TEXTURE21_ARB 0x84D5
+#define GL_TEXTURE22_ARB 0x84D6
+#define GL_TEXTURE23_ARB 0x84D7
+#define GL_TEXTURE24_ARB 0x84D8
+#define GL_TEXTURE25_ARB 0x84D9
+#define GL_TEXTURE26_ARB 0x84DA
+#define GL_TEXTURE27_ARB 0x84DB
+#define GL_TEXTURE28_ARB 0x84DC
+#define GL_TEXTURE29_ARB 0x84DD
+#define GL_TEXTURE30_ARB 0x84DE
+#define GL_TEXTURE31_ARB 0x84DF
+GLAPI void GLAPIENTRY glActiveTextureARB(GLenum texture);
+GLAPI void GLAPIENTRY glClientActiveTextureARB(GLenum texture);
+GLAPI void GLAPIENTRY glMultiTexCoord1dARB(GLenum target, GLdouble s);
+GLAPI void GLAPIENTRY glMultiTexCoord1dvARB(GLenum target, const GLdouble *v);
+GLAPI void GLAPIENTRY glMultiTexCoord1fARB(GLenum target, GLfloat s);
+GLAPI void GLAPIENTRY glMultiTexCoord1fvARB(GLenum target, const GLfloat *v);
+GLAPI void GLAPIENTRY glMultiTexCoord1iARB(GLenum target, GLint s);
+GLAPI void GLAPIENTRY glMultiTexCoord1ivARB(GLenum target, const GLint *v);
+GLAPI void GLAPIENTRY glMultiTexCoord1sARB(GLenum target, GLshort s);
+GLAPI void GLAPIENTRY glMultiTexCoord1svARB(GLenum target, const GLshort *v);
+GLAPI void GLAPIENTRY glMultiTexCoord2dARB(GLenum target, GLdouble s, GLdouble t);
+GLAPI void GLAPIENTRY glMultiTexCoord2dvARB(GLenum target, const GLdouble *v);
+GLAPI void GLAPIENTRY glMultiTexCoord2fARB(GLenum target, GLfloat s, GLfloat t);
+GLAPI void GLAPIENTRY glMultiTexCoord2fvARB(GLenum target, const GLfloat *v);
+GLAPI void GLAPIENTRY glMultiTexCoord2iARB(GLenum target, GLint s, GLint t);
+GLAPI void GLAPIENTRY glMultiTexCoord2ivARB(GLenum target, const GLint *v);
+GLAPI void GLAPIENTRY glMultiTexCoord2sARB(GLenum target, GLshort s, GLshort t);
+GLAPI void GLAPIENTRY glMultiTexCoord2svARB(GLenum target, const GLshort *v);
+GLAPI void GLAPIENTRY glMultiTexCoord3dARB(GLenum target, GLdouble s, GLdouble t, GLdouble r);
+GLAPI void GLAPIENTRY glMultiTexCoord3dvARB(GLenum target, const GLdouble *v);
+GLAPI void GLAPIENTRY glMultiTexCoord3fARB(GLenum target, GLfloat s, GLfloat t, GLfloat r);
+GLAPI void GLAPIENTRY glMultiTexCoord3fvARB(GLenum target, const GLfloat *v);
+GLAPI void GLAPIENTRY glMultiTexCoord3iARB(GLenum target, GLint s, GLint t, GLint r);
+GLAPI void GLAPIENTRY glMultiTexCoord3ivARB(GLenum target, const GLint *v);
+GLAPI void GLAPIENTRY glMultiTexCoord3sARB(GLenum target, GLshort s, GLshort t, GLshort r);
+GLAPI void GLAPIENTRY glMultiTexCoord3svARB(GLenum target, const GLshort *v);
+GLAPI void GLAPIENTRY glMultiTexCoord4dARB(GLenum target, GLdouble s, GLdouble t, GLdouble r, GLdouble q);
+GLAPI void GLAPIENTRY glMultiTexCoord4dvARB(GLenum target, const GLdouble *v);
+GLAPI void GLAPIENTRY glMultiTexCoord4fARB(GLenum target, GLfloat s, GLfloat t, GLfloat r, GLfloat q);
+GLAPI void GLAPIENTRY glMultiTexCoord4fvARB(GLenum target, const GLfloat *v);
+GLAPI void GLAPIENTRY glMultiTexCoord4iARB(GLenum target, GLint s, GLint t, GLint r, GLint q);
+GLAPI void GLAPIENTRY glMultiTexCoord4ivARB(GLenum target, const GLint *v);
+GLAPI void GLAPIENTRY glMultiTexCoord4sARB(GLenum target, GLshort s, GLshort t, GLshort r, GLshort q);
+GLAPI void GLAPIENTRY glMultiTexCoord4svARB(GLenum target, const GLshort *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD1DARBPROC) (GLenum target, GLdouble s);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD1DVARBPROC) (GLenum target, const GLdouble *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD1FARBPROC) (GLenum target, GLfloat s);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD1FVARBPROC) (GLenum target, const GLfloat *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD1IARBPROC) (GLenum target, GLint s);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD1IVARBPROC) (GLenum target, const GLint *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD1SARBPROC) (GLenum target, GLshort s);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD1SVARBPROC) (GLenum target, const GLshort *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD2DARBPROC) (GLenum target, GLdouble s, GLdouble t);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD2DVARBPROC) (GLenum target, const GLdouble *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD2FARBPROC) (GLenum target, GLfloat s, GLfloat t);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD2FVARBPROC) (GLenum target, const GLfloat *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD2IARBPROC) (GLenum target, GLint s, GLint t);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD2IVARBPROC) (GLenum target, const GLint *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD2SARBPROC) (GLenum target, GLshort s, GLshort t);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD2SVARBPROC) (GLenum target, const GLshort *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD3DARBPROC) (GLenum target, GLdouble s, GLdouble t, GLdouble r);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD3DVARBPROC) (GLenum target, const GLdouble *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD3FARBPROC) (GLenum target, GLfloat s, GLfloat t, GLfloat r);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD3FVARBPROC) (GLenum target, const GLfloat *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD3IARBPROC) (GLenum target, GLint s, GLint t, GLint r);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD3IVARBPROC) (GLenum target, const GLint *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD3SARBPROC) (GLenum target, GLshort s, GLshort t, GLshort r);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD3SVARBPROC) (GLenum target, const GLshort *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD4DARBPROC) (GLenum target, GLdouble s, GLdouble t, GLdouble r, GLdouble q);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD4DVARBPROC) (GLenum target, const GLdouble *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD4FARBPROC) (GLenum target, GLfloat s, GLfloat t, GLfloat r, GLfloat q);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD4FVARBPROC) (GLenum target, const GLfloat *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD4IARBPROC) (GLenum target, GLint s, GLint t, GLint r, GLint q);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD4IVARBPROC) (GLenum target, const GLint *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD4SARBPROC) (GLenum target, GLshort s, GLshort t, GLshort r, GLshort q);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD4SVARBPROC) (GLenum target, const GLshort *v);
+#endif /* GL_ARB_multitexture */
+ * Define this token if you want "old-style" header file behaviour (extensions
+ * defined in gl.h). Otherwise, extensions will be included from glext.h.
+ */
+#if defined(GL_GLEXT_LEGACY)
+/* All extensions that used to be here are now found in glext.h */
+#else /* GL_GLEXT_LEGACY */
+#include <GL/glext.h>
+#endif /* GL_GLEXT_LEGACY */
+#if GL_ARB_shader_objects
+#ifndef GL_MESA_shader_debug
+#define GL_MESA_shader_debug 1
+#define GL_DEBUG_OBJECT_MESA 0x8759
+#define GL_DEBUG_PRINT_MESA 0x875A
+#define GL_DEBUG_ASSERT_MESA 0x875B
+GLAPI GLhandleARB APIENTRY glCreateDebugObjectMESA (void);
+GLAPI GLvoid APIENTRY glClearDebugLogMESA (GLhandleARB obj, GLenum logType, GLenum shaderType);
+GLAPI GLvoid APIENTRY glGetDebugLogMESA (GLhandleARB obj, GLenum logType, GLenum shaderType, GLsizei maxLength,
+ GLsizei *length, GLcharARB *debugLog);
+GLAPI GLsizei APIENTRY glGetDebugLogLengthMESA (GLhandleARB obj, GLenum logType, GLenum shaderType);
+#endif /* GL_MESA_shader_debug */
+#endif /* GL_ARB_shader_objects */
+ * ???. GL_MESA_trace
+ * XXX obsolete
+ */
+#ifndef GL_MESA_trace
+#define GL_MESA_trace 1
+#define GL_TRACE_ARRAYS_BIT_MESA 0x0004
+#define GL_TRACE_PIXELS_BIT_MESA 0x0010
+#define GL_TRACE_ERRORS_BIT_MESA 0x0020
+#define GL_TRACE_MASK_MESA 0x8755
+#define GL_TRACE_NAME_MESA 0x8756
+GLAPI void GLAPIENTRY glEnableTraceMESA( GLbitfield mask );
+GLAPI void GLAPIENTRY glDisableTraceMESA( GLbitfield mask );
+GLAPI void GLAPIENTRY glNewTraceMESA( GLbitfield mask, const GLubyte * traceName );
+GLAPI void GLAPIENTRY glEndTraceMESA( void );
+GLAPI void GLAPIENTRY glTraceAssertAttribMESA( GLbitfield attribMask );
+GLAPI void GLAPIENTRY glTraceCommentMESA( const GLubyte * comment );
+GLAPI void GLAPIENTRY glTraceTextureMESA( GLuint name, const GLubyte* comment );
+GLAPI void GLAPIENTRY glTraceListMESA( GLuint name, const GLubyte* comment );
+GLAPI void GLAPIENTRY glTracePointerMESA( GLvoid* pointer, const GLubyte* comment );
+GLAPI void GLAPIENTRY glTracePointerRangeMESA( const GLvoid* first, const GLvoid* last, const GLubyte* comment );
+#endif /* GL_MESA_trace */
+ * ???. GL_MESA_packed_depth_stencil
+ * XXX obsolete
+ */
+#ifndef GL_MESA_packed_depth_stencil
+#define GL_MESA_packed_depth_stencil 1
+#define GL_DEPTH_STENCIL_MESA 0x8750
+#define GL_UNSIGNED_INT_24_8_MESA 0x8751
+#define GL_UNSIGNED_INT_8_24_REV_MESA 0x8752
+#define GL_UNSIGNED_SHORT_15_1_MESA 0x8753
+#define GL_UNSIGNED_SHORT_1_15_REV_MESA 0x8754
+#endif /* GL_MESA_packed_depth_stencil */
+#ifndef GL_MESA_program_debug
+#define GL_MESA_program_debug 1
+typedef void (*GLprogramcallbackMESA)(GLenum target, GLvoid *data);
+GLAPI void GLAPIENTRY glProgramCallbackMESA(GLenum target, GLprogramcallbackMESA callback, GLvoid *data);
+GLAPI void GLAPIENTRY glGetProgramRegisterfvMESA(GLenum target, GLsizei len, const GLubyte *name, GLfloat *v);
+#endif /* GL_MESA_program_debug */
+#ifndef GL_ATI_blend_equation_separate
+#define GL_ATI_blend_equation_separate 1
+GLAPI void GLAPIENTRY glBlendEquationSeparateATI( GLenum modeRGB, GLenum modeA );
+#endif /* GL_ATI_blend_equation_separate */
+#ifndef GL_EXT_timer_query
+#define GL_EXT_timer_query 1
+/* Define 64-bit types */
+#if defined(__STDC_VERSION__) && __STDC_VERSION__ >= 199901L
+ typedef long long int GLint64EXT;
+ typedef unsigned long long int GLuint64EXT;
+#elif defined(_WIN32)
+ typedef __int64 GLint64EXT;
+ typedef unsigned __int64 GLuint64EXT;
+ /* this might actually be a 32-bit type */
+ typedef long int GLint64EXT;
+ typedef unsigned long int GLuint64EXT;
+GLAPI void GLAPIENTRY glGetQueryObjecti64vEXT(GLuint id, GLenum pname, GLint64EXT *params);
+GLAPI void GLAPIENTRY glGetQueryObjectui64vEXT(GLuint id, GLenum pname, GLuint64EXT *params);
+typedef void (APIENTRYP PFNGLGETQUERYOBJECTI64VEXTPROC) (GLuint id, GLenum pname, GLint64EXT *params);
+typedef void (APIENTRYP PFNGLGETQUERYOBJECTUI64VEXTPROC) (GLuint id, GLenum pname, GLuint64EXT *params);
+#endif /* GL_EXT_timer_query */
+#ifndef GL_EXT_framebuffer_blit
+#define GL_EXT_framebuffer_blit 1
+GLAPI void GLAPIENTRY glBlitFramebufferEXT(GLint srcX0, GLint srcY0, GLint srcX1, GLint srcY1,
+ GLint dstX0, GLint dstY0, GLint dstX1, GLint dstY1,
+ GLbitfield mask, GLenum filter);
+ (GLint srcX0, GLint srcY0, GLint srcX1, GLint srcY1,
+ GLint dstX0, GLint dstY0, GLint dstX1, GLint dstY1,
+ GLbitfield mask, GLenum filter);
+#endif /* GL_EXT_framebuffer_blit */
+#ifndef GL_EXT_packed_depth_stencil
+#define GL_EXT_packed_depth_stencil 1
+#define GL_DEPTH_STENCIL_EXT 0x84F9
+#define GL_UNSIGNED_INT_24_8_EXT 0x84FA
+#define GL_DEPTH24_STENCIL8_EXT 0x88F0
+#endif /* GL_EXT_packed_depth_stencil */
+#ifndef GL_EXT_gpu_program_parameters
+#define GL_EXT_gpu_program_parameters 1
+GLAPI void GLAPIENTRY glProgramEnvParameters4fvEXT(GLenum target,
+ GLuint index, GLsizei count, const GLfloat *params);
+GLAPI void GLAPIENTRY glProgramLocalParameters4fvEXT(GLenum target,
+ GLuint index, GLsizei count, const GLfloat *params);
+ (GLenum target, GLuint index, GLsizei count, const GLfloat *params);
+ (GLenum target, GLuint index, GLsizei count, const GLfloat *params);
+#endif /* GL_EXT_gpu_program_parameters */
+#ifndef GL_EXT_texture_sRGB
+#define GL_EXT_texture_sRGB 1
+#define GL_SRGB_EXT 0x8C40
+#define GL_SRGB8_EXT 0x8C41
+#define GL_SRGB_ALPHA_EXT 0x8C42
+#define GL_SRGB8_ALPHA8_EXT 0x8C43
+#define GL_SLUMINANCE_EXT 0x8C46
+#define GL_SLUMINANCE8_EXT 0x8C47
+#endif /* GL_EXT_texture_sRGB */
+ ** NOTE!!!!! If you add new functions to this file, or update
+ ** glext.h be sure to regenerate the gl_mangle.h file. See comments
+ ** in that file for details.
+ **/
+ * Begin system-specific stuff
+ */
+#pragma export off
+#if defined(macintosh) && PRAGMA_IMPORT_SUPPORTED
+#pragma import off
+ * End system-specific stuff
+ **********************************************************************/
+#ifdef __cplusplus
+#endif /* __gl_h_ */
diff --git a/include/GL/gl_mangle.h b/include/GL/gl_mangle.h
new file mode 100644
index 0000000..2e6558d
--- /dev/null
+++ b/include/GL/gl_mangle.h
@@ -0,0 +1,1481 @@
+#if 0
+#define GL_MANGLE_C1 "DO NOT EDIT!!! - TO REGENERATE from gl.h, EXECUTE THIS FILE IN SHELL (/bin/sh) and save the output"
+#define GL_MANGLE_C2 "This file is used to create GL function protypes and aliases for the function names"
+ files="gl.h glext.h"
+#define GL_MANGLE_C3 "get regeneration header - copy everything in this file above the 'REGENERATE_TO_END' line"
+ awk '!done; /^\/\*REGENERATE_TO_END/ {done=1}' $0
+ echo ""
+#define GL_MANGLE_C4 get aliases
+ grep '^GLAPI' $files | sed -e 's/.*ENTRY gl\([^( ]*\).*$/#define gl\1 MANGLE(\1)/' | sort | uniq
+ echo ""
+ echo "#endif /* GL_MANGLE_H */"
+ exit
+#endif /* REGENERATION */
+ * If you compile Mesa with USE_MGL_NAMESPACE defined then you can link
+ * your application both with OpenGL and Mesa. The Mesa functions will
+ * be redefined so they are prefixed with "mgl" instead of "gl".
+ * Mgl contributed by Randy Frank (
+ * Regneration code contributed by Ray Tice (
+ */
+#ifndef GL_MANGLE_H
+#define GL_MANGLE_H
+#ifndef MANGLE
+#define MANGLE(x) mgl##x
+#endif /*MANGLE*/
+/* Internal symbols which may collide with other OpenGL implementations. */
+#define __glCoreCreateContext __mglCoreCreateContext
+#define __glCoreNopDispatch __mglCoreNopDispatch
+#define glAccum MANGLE(Accum)
+#define glActiveStencilFaceEXT MANGLE(ActiveStencilFaceEXT)
+#define glActiveTextureARB MANGLE(ActiveTextureARB)
+#define glActiveTexture MANGLE(ActiveTexture)
+#define glAlphaFragmentOp1ATI MANGLE(AlphaFragmentOp1ATI)
+#define glAlphaFragmentOp2ATI MANGLE(AlphaFragmentOp2ATI)
+#define glAlphaFragmentOp3ATI MANGLE(AlphaFragmentOp3ATI)
+#define glAlphaFunc MANGLE(AlphaFunc)
+#define glApplyTextureEXT MANGLE(ApplyTextureEXT)
+#define glAreProgramsResidentNV MANGLE(AreProgramsResidentNV)
+#define glAreTexturesResidentEXT MANGLE(AreTexturesResidentEXT)
+#define glAreTexturesResident MANGLE(AreTexturesResident)
+#define glArrayElementEXT MANGLE(ArrayElementEXT)
+#define glArrayElement MANGLE(ArrayElement)
+#define glArrayObjectATI MANGLE(ArrayObjectATI)
+#define glAsyncMarkerSGIX MANGLE(AsyncMarkerSGIX)
+#define glAttachObjectARB MANGLE(AttachObjectARB)
+#define glAttachShader MANGLE(AttachShader)
+#define glBeginFragmentShaderATI MANGLE(BeginFragmentShaderATI)
+#define glBegin MANGLE(Begin)
+#define glBeginOcclusionQueryNV MANGLE(BeginOcclusionQueryNV)
+#define glBeginQueryARB MANGLE(BeginQueryARB)
+#define glBeginQuery MANGLE(BeginQuery)
+#define glBeginVertexShaderEXT MANGLE(BeginVertexShaderEXT)
+#define glBindAttribLocationARB MANGLE(BindAttribLocationARB)
+#define glBindAttribLocation MANGLE(BindAttribLocation)
+#define glBindBufferARB MANGLE(BindBufferARB)
+#define glBindBuffer MANGLE(BindBuffer)
+#define glBindFragmentShaderATI MANGLE(BindFragmentShaderATI)
+#define glBindFramebufferEXT MANGLE(BindFramebufferEXT)
+#define glBindLightParameterEXT MANGLE(BindLightParameterEXT)
+#define glBindMaterialParameterEXT MANGLE(BindMaterialParameterEXT)
+#define glBindParameterEXT MANGLE(BindParameterEXT)
+#define glBindProgramARB MANGLE(BindProgramARB)
+#define glBindProgramNV MANGLE(BindProgramNV)
+#define glBindRenderbufferEXT MANGLE(BindRenderbufferEXT)
+#define glBindTexGenParameterEXT MANGLE(BindTexGenParameterEXT)
+#define glBindTextureEXT MANGLE(BindTextureEXT)
+#define glBindTexture MANGLE(BindTexture)
+#define glBindTextureUnitParameterEXT MANGLE(BindTextureUnitParameterEXT)
+#define glBindVertexArrayAPPLE MANGLE(BindVertexArrayAPPLE)
+#define glBindVertexShaderEXT MANGLE(BindVertexShaderEXT)
+#define glBinormal3bEXT MANGLE(Binormal3bEXT)
+#define glBinormal3bvEXT MANGLE(Binormal3bvEXT)
+#define glBinormal3dEXT MANGLE(Binormal3dEXT)
+#define glBinormal3dvEXT MANGLE(Binormal3dvEXT)
+#define glBinormal3fEXT MANGLE(Binormal3fEXT)
+#define glBinormal3fvEXT MANGLE(Binormal3fvEXT)
+#define glBinormal3iEXT MANGLE(Binormal3iEXT)
+#define glBinormal3ivEXT MANGLE(Binormal3ivEXT)
+#define glBinormal3sEXT MANGLE(Binormal3sEXT)
+#define glBinormal3svEXT MANGLE(Binormal3svEXT)
+#define glBinormalPointerEXT MANGLE(BinormalPointerEXT)
+#define glBitmap MANGLE(Bitmap)
+#define glBlendColorEXT MANGLE(BlendColorEXT)
+#define glBlendColor MANGLE(BlendColor)
+#define glBlendEquationEXT MANGLE(BlendEquationEXT)
+#define glBlendEquation MANGLE(BlendEquation)
+#define glBlendEquationSeparateATI MANGLE(BlendEquationSeparateATI)
+#define glBlendEquationSeparateEXT MANGLE(BlendEquationSeparateEXT)
+#define glBlendEquationSeparate MANGLE(BlendEquationSeparate)
+#define glBlendFunc MANGLE(BlendFunc)
+#define glBlendFuncSeparateEXT MANGLE(BlendFuncSeparateEXT)
+#define glBlendFuncSeparateINGR MANGLE(BlendFuncSeparateINGR)
+#define glBlendFuncSeparate MANGLE(BlendFuncSeparate)
+#define glBlitFramebufferEXT MANGLE(BlitFramebufferEXT)
+#define glBufferDataARB MANGLE(BufferDataARB)
+#define glBufferData MANGLE(BufferData)
+#define glBufferSubDataARB MANGLE(BufferSubDataARB)
+#define glBufferSubData MANGLE(BufferSubData)
+#define glCallList MANGLE(CallList)
+#define glCallLists MANGLE(CallLists)
+#define glCheckFramebufferStatusEXT MANGLE(CheckFramebufferStatusEXT)
+#define glClampColorARB MANGLE(ClampColorARB)
+#define glClearAccum MANGLE(ClearAccum)
+#define glClearColor MANGLE(ClearColor)
+#define glClearDebugLogMESA MANGLE(ClearDebugLogMESA)
+#define glClearDepth MANGLE(ClearDepth)
+#define glClearIndex MANGLE(ClearIndex)
+#define glClear MANGLE(Clear)
+#define glClearStencil MANGLE(ClearStencil)
+#define glClientActiveTextureARB MANGLE(ClientActiveTextureARB)
+#define glClientActiveTexture MANGLE(ClientActiveTexture)
+#define glClientActiveVertexStreamATI MANGLE(ClientActiveVertexStreamATI)
+#define glClipPlane MANGLE(ClipPlane)
+#define glColor3b MANGLE(Color3b)
+#define glColor3bv MANGLE(Color3bv)
+#define glColor3d MANGLE(Color3d)
+#define glColor3dv MANGLE(Color3dv)
+#define glColor3f MANGLE(Color3f)
+#define glColor3fVertex3fSUN MANGLE(Color3fVertex3fSUN)
+#define glColor3fVertex3fvSUN MANGLE(Color3fVertex3fvSUN)
+#define glColor3fv MANGLE(Color3fv)
+#define glColor3hNV MANGLE(Color3hNV)
+#define glColor3hvNV MANGLE(Color3hvNV)
+#define glColor3i MANGLE(Color3i)
+#define glColor3iv MANGLE(Color3iv)
+#define glColor3s MANGLE(Color3s)
+#define glColor3sv MANGLE(Color3sv)
+#define glColor3ub MANGLE(Color3ub)
+#define glColor3ubv MANGLE(Color3ubv)
+#define glColor3ui MANGLE(Color3ui)
+#define glColor3uiv MANGLE(Color3uiv)
+#define glColor3us MANGLE(Color3us)
+#define glColor3usv MANGLE(Color3usv)
+#define glColor4b MANGLE(Color4b)
+#define glColor4bv MANGLE(Color4bv)
+#define glColor4d MANGLE(Color4d)
+#define glColor4dv MANGLE(Color4dv)
+#define glColor4f MANGLE(Color4f)
+#define glColor4fNormal3fVertex3fSUN MANGLE(Color4fNormal3fVertex3fSUN)
+#define glColor4fNormal3fVertex3fvSUN MANGLE(Color4fNormal3fVertex3fvSUN)
+#define glColor4fv MANGLE(Color4fv)
+#define glColor4hNV MANGLE(Color4hNV)
+#define glColor4hvNV MANGLE(Color4hvNV)
+#define glColor4i MANGLE(Color4i)
+#define glColor4iv MANGLE(Color4iv)
+#define glColor4s MANGLE(Color4s)
+#define glColor4sv MANGLE(Color4sv)
+#define glColor4ub MANGLE(Color4ub)
+#define glColor4ubVertex2fSUN MANGLE(Color4ubVertex2fSUN)
+#define glColor4ubVertex2fvSUN MANGLE(Color4ubVertex2fvSUN)
+#define glColor4ubVertex3fSUN MANGLE(Color4ubVertex3fSUN)
+#define glColor4ubVertex3fvSUN MANGLE(Color4ubVertex3fvSUN)
+#define glColor4ubv MANGLE(Color4ubv)
+#define glColor4ui MANGLE(Color4ui)
+#define glColor4uiv MANGLE(Color4uiv)
+#define glColor4us MANGLE(Color4us)
+#define glColor4usv MANGLE(Color4usv)
+#define glColorFragmentOp1ATI MANGLE(ColorFragmentOp1ATI)
+#define glColorFragmentOp2ATI MANGLE(ColorFragmentOp2ATI)
+#define glColorFragmentOp3ATI MANGLE(ColorFragmentOp3ATI)
+#define glColorMask MANGLE(ColorMask)
+#define glColorMaterial MANGLE(ColorMaterial)
+#define glColorPointerEXT MANGLE(ColorPointerEXT)
+#define glColorPointerListIBM MANGLE(ColorPointerListIBM)
+#define glColorPointer MANGLE(ColorPointer)
+#define glColorPointervINTEL MANGLE(ColorPointervINTEL)
+#define glColorSubTableEXT MANGLE(ColorSubTableEXT)
+#define glColorSubTable MANGLE(ColorSubTable)
+#define glColorTableEXT MANGLE(ColorTableEXT)
+#define glColorTable MANGLE(ColorTable)
+#define glColorTableParameterfv MANGLE(ColorTableParameterfv)
+#define glColorTableParameterfvSGI MANGLE(ColorTableParameterfvSGI)
+#define glColorTableParameteriv MANGLE(ColorTableParameteriv)
+#define glColorTableParameterivSGI MANGLE(ColorTableParameterivSGI)
+#define glColorTableSGI MANGLE(ColorTableSGI)
+#define glCombinerInputNV MANGLE(CombinerInputNV)
+#define glCombinerOutputNV MANGLE(CombinerOutputNV)
+#define glCombinerParameterfNV MANGLE(CombinerParameterfNV)
+#define glCombinerParameterfvNV MANGLE(CombinerParameterfvNV)
+#define glCombinerParameteriNV MANGLE(CombinerParameteriNV)
+#define glCombinerParameterivNV MANGLE(CombinerParameterivNV)
+#define glCombinerStageParameterfvNV MANGLE(CombinerStageParameterfvNV)
+#define glCompileShaderARB MANGLE(CompileShaderARB)
+#define glCompileShader MANGLE(CompileShader)
+#define glCompressedTexImage1DARB MANGLE(CompressedTexImage1DARB)
+#define glCompressedTexImage1D MANGLE(CompressedTexImage1D)
+#define glCompressedTexImage2DARB MANGLE(CompressedTexImage2DARB)
+#define glCompressedTexImage2D MANGLE(CompressedTexImage2D)
+#define glCompressedTexImage3DARB MANGLE(CompressedTexImage3DARB)
+#define glCompressedTexImage3D MANGLE(CompressedTexImage3D)
+#define glCompressedTexSubImage1DARB MANGLE(CompressedTexSubImage1DARB)
+#define glCompressedTexSubImage1D MANGLE(CompressedTexSubImage1D)
+#define glCompressedTexSubImage2DARB MANGLE(CompressedTexSubImage2DARB)
+#define glCompressedTexSubImage2D MANGLE(CompressedTexSubImage2D)
+#define glCompressedTexSubImage3DARB MANGLE(CompressedTexSubImage3DARB)
+#define glCompressedTexSubImage3D MANGLE(CompressedTexSubImage3D)
+#define glConvolutionFilter1DEXT MANGLE(ConvolutionFilter1DEXT)
+#define glConvolutionFilter1D MANGLE(ConvolutionFilter1D)
+#define glConvolutionFilter2DEXT MANGLE(ConvolutionFilter2DEXT)
+#define glConvolutionFilter2D MANGLE(ConvolutionFilter2D)
+#define glConvolutionParameterfEXT MANGLE(ConvolutionParameterfEXT)
+#define glConvolutionParameterf MANGLE(ConvolutionParameterf)
+#define glConvolutionParameterfvEXT MANGLE(ConvolutionParameterfvEXT)
+#define glConvolutionParameterfv MANGLE(ConvolutionParameterfv)
+#define glConvolutionParameteriEXT MANGLE(ConvolutionParameteriEXT)
+#define glConvolutionParameteri MANGLE(ConvolutionParameteri)
+#define glConvolutionParameterivEXT MANGLE(ConvolutionParameterivEXT)
+#define glConvolutionParameteriv MANGLE(ConvolutionParameteriv)
+#define glCopyColorSubTableEXT MANGLE(CopyColorSubTableEXT)
+#define glCopyColorSubTable MANGLE(CopyColorSubTable)
+#define glCopyColorTable MANGLE(CopyColorTable)
+#define glCopyColorTableSGI MANGLE(CopyColorTableSGI)
+#define glCopyConvolutionFilter1DEXT MANGLE(CopyConvolutionFilter1DEXT)
+#define glCopyConvolutionFilter1D MANGLE(CopyConvolutionFilter1D)
+#define glCopyConvolutionFilter2DEXT MANGLE(CopyConvolutionFilter2DEXT)
+#define glCopyConvolutionFilter2D MANGLE(CopyConvolutionFilter2D)
+#define glCopyPixels MANGLE(CopyPixels)
+#define glCopyTexImage1DEXT MANGLE(CopyTexImage1DEXT)
+#define glCopyTexImage1D MANGLE(CopyTexImage1D)
+#define glCopyTexImage2DEXT MANGLE(CopyTexImage2DEXT)
+#define glCopyTexImage2D MANGLE(CopyTexImage2D)
+#define glCopyTexSubImage1DEXT MANGLE(CopyTexSubImage1DEXT)
+#define glCopyTexSubImage1D MANGLE(CopyTexSubImage1D)
+#define glCopyTexSubImage2DEXT MANGLE(CopyTexSubImage2DEXT)
+#define glCopyTexSubImage2D MANGLE(CopyTexSubImage2D)
+#define glCopyTexSubImage3DEXT MANGLE(CopyTexSubImage3DEXT)
+#define glCopyTexSubImage3D MANGLE(CopyTexSubImage3D)
+#define glCreateDebugObjectMESA MANGLE(CreateDebugObjectMESA)
+#define glCreateProgram MANGLE(CreateProgram)
+#define glCreateProgramObjectARB MANGLE(CreateProgramObjectARB)
+#define glCreateShader MANGLE(CreateShader)
+#define glCreateShaderObjectARB MANGLE(CreateShaderObjectARB)
+#define glCullFace MANGLE(CullFace)
+#define glCullParameterdvEXT MANGLE(CullParameterdvEXT)
+#define glCullParameterfvEXT MANGLE(CullParameterfvEXT)
+#define glCurrentPaletteMatrixARB MANGLE(CurrentPaletteMatrixARB)
+#define glDeformationMap3dSGIX MANGLE(DeformationMap3dSGIX)
+#define glDeformationMap3fSGIX MANGLE(DeformationMap3fSGIX)
+#define glDeformSGIX MANGLE(DeformSGIX)
+#define glDeleteAsyncMarkersSGIX MANGLE(DeleteAsyncMarkersSGIX)
+#define glDeleteBuffersARB MANGLE(DeleteBuffersARB)
+#define glDeleteBuffers MANGLE(DeleteBuffers)
+#define glDeleteFencesAPPLE MANGLE(DeleteFencesAPPLE)
+#define glDeleteFencesNV MANGLE(DeleteFencesNV)
+#define glDeleteFragmentShaderATI MANGLE(DeleteFragmentShaderATI)
+#define glDeleteFramebuffersEXT MANGLE(DeleteFramebuffersEXT)
+#define glDeleteLists MANGLE(DeleteLists)
+#define glDeleteObjectARB MANGLE(DeleteObjectARB)
+#define glDeleteOcclusionQueriesNV MANGLE(DeleteOcclusionQueriesNV)
+#define glDeleteProgram MANGLE(DeleteProgram)
+#define glDeleteProgramsARB MANGLE(DeleteProgramsARB)
+#define glDeleteProgramsNV MANGLE(DeleteProgramsNV)
+#define glDeleteQueriesARB MANGLE(DeleteQueriesARB)
+#define glDeleteQueries MANGLE(DeleteQueries)
+#define glDeleteRenderbuffersEXT MANGLE(DeleteRenderbuffersEXT)
+#define glDeleteShader MANGLE(DeleteShader)
+#define glDeleteTexturesEXT MANGLE(DeleteTexturesEXT)
+#define glDeleteTextures MANGLE(DeleteTextures)
+#define glDeleteVertexArraysAPPLE MANGLE(DeleteVertexArraysAPPLE)
+#define glDeleteVertexShaderEXT MANGLE(DeleteVertexShaderEXT)
+#define glDepthBoundsEXT MANGLE(DepthBoundsEXT)
+#define glDepthFunc MANGLE(DepthFunc)
+#define glDepthMask MANGLE(DepthMask)
+#define glDepthRange MANGLE(DepthRange)
+#define glDetachObjectARB MANGLE(DetachObjectARB)
+#define glDetachShader MANGLE(DetachShader)
+#define glDetailTexFuncSGIS MANGLE(DetailTexFuncSGIS)
+#define glDisableClientState MANGLE(DisableClientState)
+#define glDisable MANGLE(Disable)
+#define glDisableTraceMESA MANGLE(DisableTraceMESA)
+#define glDisableVariantClientStateEXT MANGLE(DisableVariantClientStateEXT)
+#define glDisableVertexAttribArrayARB MANGLE(DisableVertexAttribArrayARB)
+#define glDisableVertexAttribArray MANGLE(DisableVertexAttribArray)
+#define glDrawArraysEXT MANGLE(DrawArraysEXT)
+#define glDrawArrays MANGLE(DrawArrays)
+#define glDrawBuffer MANGLE(DrawBuffer)
+#define glDrawBuffersARB MANGLE(DrawBuffersARB)
+#define glDrawBuffersATI MANGLE(DrawBuffersATI)
+#define glDrawBuffers MANGLE(DrawBuffers)
+#define glDrawElementArrayAPPLE MANGLE(DrawElementArrayAPPLE)
+#define glDrawElementArrayATI MANGLE(DrawElementArrayATI)
+#define glDrawElements MANGLE(DrawElements)
+#define glDrawMeshArraysSUN MANGLE(DrawMeshArraysSUN)
+#define glDrawPixels MANGLE(DrawPixels)
+#define glDrawRangeElementArrayAPPLE MANGLE(DrawRangeElementArrayAPPLE)
+#define glDrawRangeElementArrayATI MANGLE(DrawRangeElementArrayATI)
+#define glDrawRangeElementsEXT MANGLE(DrawRangeElementsEXT)
+#define glDrawRangeElements MANGLE(DrawRangeElements)
+#define glEdgeFlag MANGLE(EdgeFlag)
+#define glEdgeFlagPointerEXT MANGLE(EdgeFlagPointerEXT)
+#define glEdgeFlagPointerListIBM MANGLE(EdgeFlagPointerListIBM)
+#define glEdgeFlagPointer MANGLE(EdgeFlagPointer)
+#define glEdgeFlagv MANGLE(EdgeFlagv)
+#define glElementPointerAPPLE MANGLE(ElementPointerAPPLE)
+#define glElementPointerATI MANGLE(ElementPointerATI)
+#define glEnableClientState MANGLE(EnableClientState)
+#define glEnable MANGLE(Enable)
+#define glEnableTraceMESA MANGLE(EnableTraceMESA)
+#define glEnableVariantClientStateEXT MANGLE(EnableVariantClientStateEXT)
+#define glEnableVertexAttribArrayARB MANGLE(EnableVertexAttribArrayARB)
+#define glEnableVertexAttribArray MANGLE(EnableVertexAttribArray)
+#define glEndFragmentShaderATI MANGLE(EndFragmentShaderATI)
+#define glEndList MANGLE(EndList)
+#define glEnd MANGLE(End)
+#define glEndOcclusionQueryNV MANGLE(EndOcclusionQueryNV)
+#define glEndQueryARB MANGLE(EndQueryARB)
+#define glEndQuery MANGLE(EndQuery)
+#define glEndTraceMESA MANGLE(EndTraceMESA)
+#define glEndVertexShaderEXT MANGLE(EndVertexShaderEXT)
+#define glEvalCoord1d MANGLE(EvalCoord1d)
+#define glEvalCoord1dv MANGLE(EvalCoord1dv)
+#define glEvalCoord1f MANGLE(EvalCoord1f)
+#define glEvalCoord1fv MANGLE(EvalCoord1fv)
+#define glEvalCoord2d MANGLE(EvalCoord2d)
+#define glEvalCoord2dv MANGLE(EvalCoord2dv)
+#define glEvalCoord2f MANGLE(EvalCoord2f)
+#define glEvalCoord2fv MANGLE(EvalCoord2fv)
+#define glEvalMapsNV MANGLE(EvalMapsNV)
+#define glEvalMesh1 MANGLE(EvalMesh1)
+#define glEvalMesh2 MANGLE(EvalMesh2)
+#define glEvalPoint1 MANGLE(EvalPoint1)
+#define glEvalPoint2 MANGLE(EvalPoint2)
+#define glExecuteProgramNV MANGLE(ExecuteProgramNV)
+#define glExtractComponentEXT MANGLE(ExtractComponentEXT)
+#define glFeedbackBuffer MANGLE(FeedbackBuffer)
+#define glFinalCombinerInputNV MANGLE(FinalCombinerInputNV)
+#define glFinishAsyncSGIX MANGLE(FinishAsyncSGIX)
+#define glFinishFenceAPPLE MANGLE(FinishFenceAPPLE)
+#define glFinishFenceNV MANGLE(FinishFenceNV)
+#define glFinish MANGLE(Finish)
+#define glFinishObjectAPPLE MANGLE(FinishObjectAPPLE)
+#define glFinishTextureSUNX MANGLE(FinishTextureSUNX)
+#define glFlush MANGLE(Flush)
+#define glFlushPixelDataRangeNV MANGLE(FlushPixelDataRangeNV)
+#define glFlushRasterSGIX MANGLE(FlushRasterSGIX)
+#define glFlushVertexArrayRangeAPPLE MANGLE(FlushVertexArrayRangeAPPLE)
+#define glFlushVertexArrayRangeNV MANGLE(FlushVertexArrayRangeNV)
+#define glFogCoorddEXT MANGLE(FogCoorddEXT)
+#define glFogCoordd MANGLE(FogCoordd)
+#define glFogCoorddvEXT MANGLE(FogCoorddvEXT)
+#define glFogCoorddv MANGLE(FogCoorddv)
+#define glFogCoordfEXT MANGLE(FogCoordfEXT)
+#define glFogCoordf MANGLE(FogCoordf)
+#define glFogCoordfvEXT MANGLE(FogCoordfvEXT)
+#define glFogCoordfv MANGLE(FogCoordfv)
+#define glFogCoordhNV MANGLE(FogCoordhNV)
+#define glFogCoordhvNV MANGLE(FogCoordhvNV)
+#define glFogCoordPointerEXT MANGLE(FogCoordPointerEXT)
+#define glFogCoordPointerListIBM MANGLE(FogCoordPointerListIBM)
+#define glFogCoordPointer MANGLE(FogCoordPointer)
+#define glFogf MANGLE(Fogf)
+#define glFogFuncSGIS MANGLE(FogFuncSGIS)
+#define glFogfv MANGLE(Fogfv)
+#define glFogi MANGLE(Fogi)
+#define glFogiv MANGLE(Fogiv)
+#define glFragmentColorMaterialSGIX MANGLE(FragmentColorMaterialSGIX)
+#define glFragmentLightfSGIX MANGLE(FragmentLightfSGIX)
+#define glFragmentLightfvSGIX MANGLE(FragmentLightfvSGIX)
+#define glFragmentLightiSGIX MANGLE(FragmentLightiSGIX)
+#define glFragmentLightivSGIX MANGLE(FragmentLightivSGIX)
+#define glFragmentLightModelfSGIX MANGLE(FragmentLightModelfSGIX)
+#define glFragmentLightModelfvSGIX MANGLE(FragmentLightModelfvSGIX)
+#define glFragmentLightModeliSGIX MANGLE(FragmentLightModeliSGIX)
+#define glFragmentLightModelivSGIX MANGLE(FragmentLightModelivSGIX)
+#define glFragmentMaterialfSGIX MANGLE(FragmentMaterialfSGIX)
+#define glFragmentMaterialfvSGIX MANGLE(FragmentMaterialfvSGIX)
+#define glFragmentMaterialiSGIX MANGLE(FragmentMaterialiSGIX)
+#define glFragmentMaterialivSGIX MANGLE(FragmentMaterialivSGIX)
+#define glFramebufferRenderbufferEXT MANGLE(FramebufferRenderbufferEXT)
+#define glFramebufferTexture1DEXT MANGLE(FramebufferTexture1DEXT)
+#define glFramebufferTexture2DEXT MANGLE(FramebufferTexture2DEXT)
+#define glFramebufferTexture3DEXT MANGLE(FramebufferTexture3DEXT)
+#define glFrameZoomSGIX MANGLE(FrameZoomSGIX)
+#define glFreeObjectBufferATI MANGLE(FreeObjectBufferATI)
+#define glFrontFace MANGLE(FrontFace)
+#define glFrustum MANGLE(Frustum)
+#define glGenAsyncMarkersSGIX MANGLE(GenAsyncMarkersSGIX)
+#define glGenBuffersARB MANGLE(GenBuffersARB)
+#define glGenBuffers MANGLE(GenBuffers)
+#define glGenerateMipmapEXT MANGLE(GenerateMipmapEXT)
+#define glGenFencesAPPLE MANGLE(GenFencesAPPLE)
+#define glGenFencesNV MANGLE(GenFencesNV)
+#define glGenFragmentShadersATI MANGLE(GenFragmentShadersATI)
+#define glGenFramebuffersEXT MANGLE(GenFramebuffersEXT)
+#define glGenLists MANGLE(GenLists)
+#define glGenOcclusionQueriesNV MANGLE(GenOcclusionQueriesNV)
+#define glGenProgramsARB MANGLE(GenProgramsARB)
+#define glGenProgramsNV MANGLE(GenProgramsNV)
+#define glGenQueriesARB MANGLE(GenQueriesARB)
+#define glGenQueries MANGLE(GenQueries)
+#define glGenRenderbuffersEXT MANGLE(GenRenderbuffersEXT)
+#define glGenSymbolsEXT MANGLE(GenSymbolsEXT)
+#define glGenTexturesEXT MANGLE(GenTexturesEXT)
+#define glGenTextures MANGLE(GenTextures)
+#define glGenVertexArraysAPPLE MANGLE(GenVertexArraysAPPLE)
+#define glGenVertexShadersEXT MANGLE(GenVertexShadersEXT)
+#define glGetActiveAttribARB MANGLE(GetActiveAttribARB)
+#define glGetActiveAttrib MANGLE(GetActiveAttrib)
+#define glGetActiveUniformARB MANGLE(GetActiveUniformARB)
+#define glGetActiveUniform MANGLE(GetActiveUniform)
+#define glGetArrayObjectfvATI MANGLE(GetArrayObjectfvATI)
+#define glGetArrayObjectivATI MANGLE(GetArrayObjectivATI)
+#define glGetAttachedObjectsARB MANGLE(GetAttachedObjectsARB)
+#define glGetAttachedShaders MANGLE(GetAttachedShaders)
+#define glGetAttribLocationARB MANGLE(GetAttribLocationARB)
+#define glGetAttribLocation MANGLE(GetAttribLocation)
+#define glGetBooleanv MANGLE(GetBooleanv)
+#define glGetBufferParameterivARB MANGLE(GetBufferParameterivARB)
+#define glGetBufferParameteriv MANGLE(GetBufferParameteriv)
+#define glGetBufferPointervARB MANGLE(GetBufferPointervARB)
+#define glGetBufferPointerv MANGLE(GetBufferPointerv)
+#define glGetBufferSubDataARB MANGLE(GetBufferSubDataARB)
+#define glGetBufferSubData MANGLE(GetBufferSubData)
+#define glGetClipPlane MANGLE(GetClipPlane)
+#define glGetColorTableEXT MANGLE(GetColorTableEXT)
+#define glGetColorTable MANGLE(GetColorTable)
+#define glGetColorTableParameterfvEXT MANGLE(GetColorTableParameterfvEXT)
+#define glGetColorTableParameterfv MANGLE(GetColorTableParameterfv)
+#define glGetColorTableParameterfvSGI MANGLE(GetColorTableParameterfvSGI)
+#define glGetColorTableParameterivEXT MANGLE(GetColorTableParameterivEXT)
+#define glGetColorTableParameteriv MANGLE(GetColorTableParameteriv)
+#define glGetColorTableParameterivSGI MANGLE(GetColorTableParameterivSGI)
+#define glGetColorTableSGI MANGLE(GetColorTableSGI)
+#define glGetCombinerInputParameterfvNV MANGLE(GetCombinerInputParameterfvNV)
+#define glGetCombinerInputParameterivNV MANGLE(GetCombinerInputParameterivNV)
+#define glGetCombinerOutputParameterfvNV MANGLE(GetCombinerOutputParameterfvNV)
+#define glGetCombinerOutputParameterivNV MANGLE(GetCombinerOutputParameterivNV)
+#define glGetCombinerStageParameterfvNV MANGLE(GetCombinerStageParameterfvNV)
+#define glGetCompressedTexImageARB MANGLE(GetCompressedTexImageARB)
+#define glGetCompressedTexImage MANGLE(GetCompressedTexImage)
+#define glGetConvolutionFilterEXT MANGLE(GetConvolutionFilterEXT)
+#define glGetConvolutionFilter MANGLE(GetConvolutionFilter)
+#define glGetConvolutionParameterfvEXT MANGLE(GetConvolutionParameterfvEXT)
+#define glGetConvolutionParameterfv MANGLE(GetConvolutionParameterfv)
+#define glGetConvolutionParameterivEXT MANGLE(GetConvolutionParameterivEXT)
+#define glGetConvolutionParameteriv MANGLE(GetConvolutionParameteriv)
+#define glGetDebugLogLengthMESA MANGLE(GetDebugLogLengthMESA)
+#define glGetDebugLogMESA MANGLE(GetDebugLogMESA)
+#define glGetDetailTexFuncSGIS MANGLE(GetDetailTexFuncSGIS)
+#define glGetDoublev MANGLE(GetDoublev)
+#define glGetError MANGLE(GetError)
+#define glGetFenceivNV MANGLE(GetFenceivNV)
+#define glGetFinalCombinerInputParameterfvNV MANGLE(GetFinalCombinerInputParameterfvNV)
+#define glGetFinalCombinerInputParameterivNV MANGLE(GetFinalCombinerInputParameterivNV)
+#define glGetFloatv MANGLE(GetFloatv)
+#define glGetFogFuncSGIS MANGLE(GetFogFuncSGIS)
+#define glGetFragmentLightfvSGIX MANGLE(GetFragmentLightfvSGIX)
+#define glGetFragmentLightivSGIX MANGLE(GetFragmentLightivSGIX)
+#define glGetFragmentMaterialfvSGIX MANGLE(GetFragmentMaterialfvSGIX)
+#define glGetFragmentMaterialivSGIX MANGLE(GetFragmentMaterialivSGIX)
+#define glGetFramebufferAttachmentParameterivEXT MANGLE(GetFramebufferAttachmentParameterivEXT)
+#define glGetHandleARB MANGLE(GetHandleARB)
+#define glGetHistogramEXT MANGLE(GetHistogramEXT)
+#define glGetHistogram MANGLE(GetHistogram)
+#define glGetHistogramParameterfvEXT MANGLE(GetHistogramParameterfvEXT)
+#define glGetHistogramParameterfv MANGLE(GetHistogramParameterfv)
+#define glGetHistogramParameterivEXT MANGLE(GetHistogramParameterivEXT)
+#define glGetHistogramParameteriv MANGLE(GetHistogramParameteriv)
+#define glGetImageTransformParameterfvHP MANGLE(GetImageTransformParameterfvHP)
+#define glGetImageTransformParameterivHP MANGLE(GetImageTransformParameterivHP)
+#define glGetInfoLogARB MANGLE(GetInfoLogARB)
+#define glGetInstrumentsSGIX MANGLE(GetInstrumentsSGIX)
+#define glGetIntegerv MANGLE(GetIntegerv)
+#define glGetInvariantBooleanvEXT MANGLE(GetInvariantBooleanvEXT)
+#define glGetInvariantFloatvEXT MANGLE(GetInvariantFloatvEXT)
+#define glGetInvariantIntegervEXT MANGLE(GetInvariantIntegervEXT)
+#define glGetLightfv MANGLE(GetLightfv)
+#define glGetLightiv MANGLE(GetLightiv)
+#define glGetListParameterfvSGIX MANGLE(GetListParameterfvSGIX)
+#define glGetListParameterivSGIX MANGLE(GetListParameterivSGIX)
+#define glGetLocalConstantBooleanvEXT MANGLE(GetLocalConstantBooleanvEXT)
+#define glGetLocalConstantFloatvEXT MANGLE(GetLocalConstantFloatvEXT)
+#define glGetLocalConstantIntegervEXT MANGLE(GetLocalConstantIntegervEXT)
+#define glGetMapAttribParameterfvNV MANGLE(GetMapAttribParameterfvNV)
+#define glGetMapAttribParameterivNV MANGLE(GetMapAttribParameterivNV)
+#define glGetMapControlPointsNV MANGLE(GetMapControlPointsNV)
+#define glGetMapdv MANGLE(GetMapdv)
+#define glGetMapfv MANGLE(GetMapfv)
+#define glGetMapiv MANGLE(GetMapiv)
+#define glGetMapParameterfvNV MANGLE(GetMapParameterfvNV)
+#define glGetMapParameterivNV MANGLE(GetMapParameterivNV)
+#define glGetMaterialfv MANGLE(GetMaterialfv)
+#define glGetMaterialiv MANGLE(GetMaterialiv)
+#define glGetMinmaxEXT MANGLE(GetMinmaxEXT)
+#define glGetMinmax MANGLE(GetMinmax)
+#define glGetMinmaxParameterfvEXT MANGLE(GetMinmaxParameterfvEXT)
+#define glGetMinmaxParameterfv MANGLE(GetMinmaxParameterfv)
+#define glGetMinmaxParameterivEXT MANGLE(GetMinmaxParameterivEXT)
+#define glGetMinmaxParameteriv MANGLE(GetMinmaxParameteriv)
+#define glGetObjectBufferfvATI MANGLE(GetObjectBufferfvATI)
+#define glGetObjectBufferivATI MANGLE(GetObjectBufferivATI)
+#define glGetObjectParameterfvARB MANGLE(GetObjectParameterfvARB)
+#define glGetObjectParameterivARB MANGLE(GetObjectParameterivARB)
+#define glGetOcclusionQueryivNV MANGLE(GetOcclusionQueryivNV)
+#define glGetOcclusionQueryuivNV MANGLE(GetOcclusionQueryuivNV)
+#define glGetPixelMapfv MANGLE(GetPixelMapfv)
+#define glGetPixelMapuiv MANGLE(GetPixelMapuiv)
+#define glGetPixelMapusv MANGLE(GetPixelMapusv)
+#define glGetPixelTexGenParameterfvSGIS MANGLE(GetPixelTexGenParameterfvSGIS)
+#define glGetPixelTexGenParameterivSGIS MANGLE(GetPixelTexGenParameterivSGIS)
+#define glGetPointervEXT MANGLE(GetPointervEXT)
+#define glGetPointerv MANGLE(GetPointerv)
+#define glGetPolygonStipple MANGLE(GetPolygonStipple)
+#define glGetProgramEnvParameterdvARB MANGLE(GetProgramEnvParameterdvARB)
+#define glGetProgramEnvParameterfvARB MANGLE(GetProgramEnvParameterfvARB)
+#define glGetProgramInfoLog MANGLE(GetProgramInfoLog)
+#define glGetProgramivARB MANGLE(GetProgramivARB)
+#define glGetProgramiv MANGLE(GetProgramiv)
+#define glGetProgramivNV MANGLE(GetProgramivNV)
+#define glGetProgramLocalParameterdvARB MANGLE(GetProgramLocalParameterdvARB)
+#define glGetProgramLocalParameterfvARB MANGLE(GetProgramLocalParameterfvARB)
+#define glGetProgramNamedParameterdvNV MANGLE(GetProgramNamedParameterdvNV)
+#define glGetProgramNamedParameterfvNV MANGLE(GetProgramNamedParameterfvNV)
+#define glGetProgramParameterdvNV MANGLE(GetProgramParameterdvNV)
+#define glGetProgramParameterfvNV MANGLE(GetProgramParameterfvNV)
+#define glGetProgramRegisterfvMESA MANGLE(GetProgramRegisterfvMESA)
+#define glGetProgramStringARB MANGLE(GetProgramStringARB)
+#define glGetProgramStringNV MANGLE(GetProgramStringNV)
+#define glGetQueryivARB MANGLE(GetQueryivARB)
+#define glGetQueryiv MANGLE(GetQueryiv)
+#define glGetQueryObjecti64vEXT MANGLE(GetQueryObjecti64vEXT)
+#define glGetQueryObjectivARB MANGLE(GetQueryObjectivARB)
+#define glGetQueryObjectiv MANGLE(GetQueryObjectiv)
+#define glGetQueryObjectui64vEXT MANGLE(GetQueryObjectui64vEXT)
+#define glGetQueryObjectuivARB MANGLE(GetQueryObjectuivARB)
+#define glGetQueryObjectuiv MANGLE(GetQueryObjectuiv)
+#define glGetRenderbufferParameterivEXT MANGLE(GetRenderbufferParameterivEXT)
+#define glGetSeparableFilterEXT MANGLE(GetSeparableFilterEXT)
+#define glGetSeparableFilter MANGLE(GetSeparableFilter)
+#define glGetShaderInfoLog MANGLE(GetShaderInfoLog)
+#define glGetShaderiv MANGLE(GetShaderiv)
+#define glGetShaderSourceARB MANGLE(GetShaderSourceARB)
+#define glGetShaderSource MANGLE(GetShaderSource)
+#define glGetSharpenTexFuncSGIS MANGLE(GetSharpenTexFuncSGIS)
+#define glGetString MANGLE(GetString)
+#define glGetTexBumpParameterfvATI MANGLE(GetTexBumpParameterfvATI)
+#define glGetTexBumpParameterivATI MANGLE(GetTexBumpParameterivATI)
+#define glGetTexEnvfv MANGLE(GetTexEnvfv)
+#define glGetTexEnviv MANGLE(GetTexEnviv)
+#define glGetTexFilterFuncSGIS MANGLE(GetTexFilterFuncSGIS)
+#define glGetTexGendv MANGLE(GetTexGendv)
+#define glGetTexGenfv MANGLE(GetTexGenfv)
+#define glGetTexGeniv MANGLE(GetTexGeniv)
+#define glGetTexImage MANGLE(GetTexImage)
+#define glGetTexLevelParameterfv MANGLE(GetTexLevelParameterfv)
+#define glGetTexLevelParameteriv MANGLE(GetTexLevelParameteriv)
+#define glGetTexParameterfv MANGLE(GetTexParameterfv)
+#define glGetTexParameteriv MANGLE(GetTexParameteriv)
+#define glGetTrackMatrixivNV MANGLE(GetTrackMatrixivNV)
+#define glGetUniformfvARB MANGLE(GetUniformfvARB)
+#define glGetUniformfv MANGLE(GetUniformfv)
+#define glGetUniformivARB MANGLE(GetUniformivARB)
+#define glGetUniformiv MANGLE(GetUniformiv)
+#define glGetUniformLocationARB MANGLE(GetUniformLocationARB)
+#define glGetUniformLocation MANGLE(GetUniformLocation)
+#define glGetVariantArrayObjectfvATI MANGLE(GetVariantArrayObjectfvATI)
+#define glGetVariantArrayObjectivATI MANGLE(GetVariantArrayObjectivATI)
+#define glGetVariantBooleanvEXT MANGLE(GetVariantBooleanvEXT)
+#define glGetVariantFloatvEXT MANGLE(GetVariantFloatvEXT)
+#define glGetVariantIntegervEXT MANGLE(GetVariantIntegervEXT)
+#define glGetVariantPointervEXT MANGLE(GetVariantPointervEXT)
+#define glGetVertexAttribArrayObjectfvATI MANGLE(GetVertexAttribArrayObjectfvATI)
+#define glGetVertexAttribArrayObjectivATI MANGLE(GetVertexAttribArrayObjectivATI)
+#define glGetVertexAttribdvARB MANGLE(GetVertexAttribdvARB)
+#define glGetVertexAttribdv MANGLE(GetVertexAttribdv)
+#define glGetVertexAttribdvNV MANGLE(GetVertexAttribdvNV)
+#define glGetVertexAttribfvARB MANGLE(GetVertexAttribfvARB)
+#define glGetVertexAttribfv MANGLE(GetVertexAttribfv)
+#define glGetVertexAttribfvNV MANGLE(GetVertexAttribfvNV)
+#define glGetVertexAttribivARB MANGLE(GetVertexAttribivARB)
+#define glGetVertexAttribiv MANGLE(GetVertexAttribiv)
+#define glGetVertexAttribivNV MANGLE(GetVertexAttribivNV)
+#define glGetVertexAttribPointervARB MANGLE(GetVertexAttribPointervARB)
+#define glGetVertexAttribPointerv MANGLE(GetVertexAttribPointerv)
+#define glGetVertexAttribPointervNV MANGLE(GetVertexAttribPointervNV)
+#define glGlobalAlphaFactorbSUN MANGLE(GlobalAlphaFactorbSUN)
+#define glGlobalAlphaFactordSUN MANGLE(GlobalAlphaFactordSUN)
+#define glGlobalAlphaFactorfSUN MANGLE(GlobalAlphaFactorfSUN)
+#define glGlobalAlphaFactoriSUN MANGLE(GlobalAlphaFactoriSUN)
+#define glGlobalAlphaFactorsSUN MANGLE(GlobalAlphaFactorsSUN)
+#define glGlobalAlphaFactorubSUN MANGLE(GlobalAlphaFactorubSUN)
+#define glGlobalAlphaFactoruiSUN MANGLE(GlobalAlphaFactoruiSUN)
+#define glGlobalAlphaFactorusSUN MANGLE(GlobalAlphaFactorusSUN)
+#define glHint MANGLE(Hint)
+#define glHintPGI MANGLE(HintPGI)
+#define glHistogramEXT MANGLE(HistogramEXT)
+#define glHistogram MANGLE(Histogram)
+#define glIglooInterfaceSGIX MANGLE(IglooInterfaceSGIX)
+#define glImageTransformParameterfHP MANGLE(ImageTransformParameterfHP)
+#define glImageTransformParameterfvHP MANGLE(ImageTransformParameterfvHP)
+#define glImageTransformParameteriHP MANGLE(ImageTransformParameteriHP)
+#define glImageTransformParameterivHP MANGLE(ImageTransformParameterivHP)
+#define glIndexd MANGLE(Indexd)
+#define glIndexdv MANGLE(Indexdv)
+#define glIndexf MANGLE(Indexf)
+#define glIndexFuncEXT MANGLE(IndexFuncEXT)
+#define glIndexfv MANGLE(Indexfv)
+#define glIndexi MANGLE(Indexi)
+#define glIndexiv MANGLE(Indexiv)
+#define glIndexMask MANGLE(IndexMask)
+#define glIndexMaterialEXT MANGLE(IndexMaterialEXT)
+#define glIndexPointerEXT MANGLE(IndexPointerEXT)
+#define glIndexPointerListIBM MANGLE(IndexPointerListIBM)
+#define glIndexPointer MANGLE(IndexPointer)
+#define glIndexs MANGLE(Indexs)
+#define glIndexsv MANGLE(Indexsv)
+#define glIndexub MANGLE(Indexub)
+#define glIndexubv MANGLE(Indexubv)
+#define glInitNames MANGLE(InitNames)
+#define glInsertComponentEXT MANGLE(InsertComponentEXT)
+#define glInstrumentsBufferSGIX MANGLE(InstrumentsBufferSGIX)
+#define glInterleavedArrays MANGLE(InterleavedArrays)
+#define glIsAsyncMarkerSGIX MANGLE(IsAsyncMarkerSGIX)
+#define glIsBufferARB MANGLE(IsBufferARB)
+#define glIsBuffer MANGLE(IsBuffer)
+#define glIsEnabled MANGLE(IsEnabled)
+#define glIsFenceAPPLE MANGLE(IsFenceAPPLE)
+#define glIsFenceNV MANGLE(IsFenceNV)
+#define glIsFramebufferEXT MANGLE(IsFramebufferEXT)
+#define glIsList MANGLE(IsList)
+#define glIsObjectBufferATI MANGLE(IsObjectBufferATI)
+#define glIsOcclusionQueryNV MANGLE(IsOcclusionQueryNV)
+#define glIsProgramARB MANGLE(IsProgramARB)
+#define glIsProgram MANGLE(IsProgram)
+#define glIsProgramNV MANGLE(IsProgramNV)
+#define glIsQueryARB MANGLE(IsQueryARB)
+#define glIsQuery MANGLE(IsQuery)
+#define glIsRenderbufferEXT MANGLE(IsRenderbufferEXT)
+#define glIsShader MANGLE(IsShader)
+#define glIsTextureEXT MANGLE(IsTextureEXT)
+#define glIsTexture MANGLE(IsTexture)
+#define glIsVariantEnabledEXT MANGLE(IsVariantEnabledEXT)
+#define glIsVertexArrayAPPLE MANGLE(IsVertexArrayAPPLE)
+#define glLightEnviSGIX MANGLE(LightEnviSGIX)
+#define glLightf MANGLE(Lightf)
+#define glLightfv MANGLE(Lightfv)
+#define glLighti MANGLE(Lighti)
+#define glLightiv MANGLE(Lightiv)
+#define glLightModelf MANGLE(LightModelf)
+#define glLightModelfv MANGLE(LightModelfv)
+#define glLightModeli MANGLE(LightModeli)
+#define glLightModeliv MANGLE(LightModeliv)
+#define glLineStipple MANGLE(LineStipple)
+#define glLineWidth MANGLE(LineWidth)
+#define glLinkProgramARB MANGLE(LinkProgramARB)
+#define glLinkProgram MANGLE(LinkProgram)
+#define glListBase MANGLE(ListBase)
+#define glListParameterfSGIX MANGLE(ListParameterfSGIX)
+#define glListParameterfvSGIX MANGLE(ListParameterfvSGIX)
+#define glListParameteriSGIX MANGLE(ListParameteriSGIX)
+#define glListParameterivSGIX MANGLE(ListParameterivSGIX)
+#define glLoadIdentityDeformationMapSGIX MANGLE(LoadIdentityDeformationMapSGIX)
+#define glLoadIdentity MANGLE(LoadIdentity)
+#define glLoadMatrixd MANGLE(LoadMatrixd)
+#define glLoadMatrixf MANGLE(LoadMatrixf)
+#define glLoadName MANGLE(LoadName)
+#define glLoadProgramNV MANGLE(LoadProgramNV)
+#define glLoadTransposeMatrixdARB MANGLE(LoadTransposeMatrixdARB)
+#define glLoadTransposeMatrixd MANGLE(LoadTransposeMatrixd)
+#define glLoadTransposeMatrixfARB MANGLE(LoadTransposeMatrixfARB)
+#define glLoadTransposeMatrixf MANGLE(LoadTransposeMatrixf)
+#define glLockArraysEXT MANGLE(LockArraysEXT)
+#define glLogicOp MANGLE(LogicOp)
+#define glMap1d MANGLE(Map1d)
+#define glMap1f MANGLE(Map1f)
+#define glMap2d MANGLE(Map2d)
+#define glMap2f MANGLE(Map2f)
+#define glMapBufferARB MANGLE(MapBufferARB)
+#define glMapBuffer MANGLE(MapBuffer)
+#define glMapControlPointsNV MANGLE(MapControlPointsNV)
+#define glMapGrid1d MANGLE(MapGrid1d)
+#define glMapGrid1f MANGLE(MapGrid1f)
+#define glMapGrid2d MANGLE(MapGrid2d)
+#define glMapGrid2f MANGLE(MapGrid2f)
+#define glMapObjectBufferATI MANGLE(MapObjectBufferATI)
+#define glMapParameterfvNV MANGLE(MapParameterfvNV)
+#define glMapParameterivNV MANGLE(MapParameterivNV)
+#define glMaterialf MANGLE(Materialf)
+#define glMaterialfv MANGLE(Materialfv)
+#define glMateriali MANGLE(Materiali)
+#define glMaterialiv MANGLE(Materialiv)
+#define glMatrixIndexPointerARB MANGLE(MatrixIndexPointerARB)
+#define glMatrixIndexubvARB MANGLE(MatrixIndexubvARB)
+#define glMatrixIndexuivARB MANGLE(MatrixIndexuivARB)
+#define glMatrixIndexusvARB MANGLE(MatrixIndexusvARB)
+#define glMatrixMode MANGLE(MatrixMode)
+#define glMinmaxEXT MANGLE(MinmaxEXT)
+#define glMinmax MANGLE(Minmax)
+#define glMultiDrawArraysEXT MANGLE(MultiDrawArraysEXT)
+#define glMultiDrawArrays MANGLE(MultiDrawArrays)
+#define glMultiDrawElementArrayAPPLE MANGLE(MultiDrawElementArrayAPPLE)
+#define glMultiDrawElementsEXT MANGLE(MultiDrawElementsEXT)
+#define glMultiDrawElements MANGLE(MultiDrawElements)
+#define glMultiDrawRangeElementArrayAPPLE MANGLE(MultiDrawRangeElementArrayAPPLE)
+#define glMultiModeDrawArraysIBM MANGLE(MultiModeDrawArraysIBM)
+#define glMultiModeDrawElementsIBM MANGLE(MultiModeDrawElementsIBM)
+#define glMultiTexCoord1dARB MANGLE(MultiTexCoord1dARB)
+#define glMultiTexCoord1d MANGLE(MultiTexCoord1d)
+#define glMultiTexCoord1dvARB MANGLE(MultiTexCoord1dvARB)
+#define glMultiTexCoord1dv MANGLE(MultiTexCoord1dv)
+#define glMultiTexCoord1fARB MANGLE(MultiTexCoord1fARB)
+#define glMultiTexCoord1f MANGLE(MultiTexCoord1f)
+#define glMultiTexCoord1fvARB MANGLE(MultiTexCoord1fvARB)
+#define glMultiTexCoord1fv MANGLE(MultiTexCoord1fv)
+#define glMultiTexCoord1hNV MANGLE(MultiTexCoord1hNV)
+#define glMultiTexCoord1hvNV MANGLE(MultiTexCoord1hvNV)
+#define glMultiTexCoord1iARB MANGLE(MultiTexCoord1iARB)
+#define glMultiTexCoord1i MANGLE(MultiTexCoord1i)
+#define glMultiTexCoord1ivARB MANGLE(MultiTexCoord1ivARB)
+#define glMultiTexCoord1iv MANGLE(MultiTexCoord1iv)
+#define glMultiTexCoord1sARB MANGLE(MultiTexCoord1sARB)
+#define glMultiTexCoord1s MANGLE(MultiTexCoord1s)
+#define glMultiTexCoord1svARB MANGLE(MultiTexCoord1svARB)
+#define glMultiTexCoord1sv MANGLE(MultiTexCoord1sv)
+#define glMultiTexCoord2dARB MANGLE(MultiTexCoord2dARB)
+#define glMultiTexCoord2d MANGLE(MultiTexCoord2d)
+#define glMultiTexCoord2dvARB MANGLE(MultiTexCoord2dvARB)
+#define glMultiTexCoord2dv MANGLE(MultiTexCoord2dv)
+#define glMultiTexCoord2fARB MANGLE(MultiTexCoord2fARB)
+#define glMultiTexCoord2f MANGLE(MultiTexCoord2f)
+#define glMultiTexCoord2fvARB MANGLE(MultiTexCoord2fvARB)
+#define glMultiTexCoord2fv MANGLE(MultiTexCoord2fv)
+#define glMultiTexCoord2hNV MANGLE(MultiTexCoord2hNV)
+#define glMultiTexCoord2hvNV MANGLE(MultiTexCoord2hvNV)
+#define glMultiTexCoord2iARB MANGLE(MultiTexCoord2iARB)
+#define glMultiTexCoord2i MANGLE(MultiTexCoord2i)
+#define glMultiTexCoord2ivARB MANGLE(MultiTexCoord2ivARB)
+#define glMultiTexCoord2iv MANGLE(MultiTexCoord2iv)
+#define glMultiTexCoord2sARB MANGLE(MultiTexCoord2sARB)
+#define glMultiTexCoord2s MANGLE(MultiTexCoord2s)
+#define glMultiTexCoord2svARB MANGLE(MultiTexCoord2svARB)
+#define glMultiTexCoord2sv MANGLE(MultiTexCoord2sv)
+#define glMultiTexCoord3dARB MANGLE(MultiTexCoord3dARB)
+#define glMultiTexCoord3d MANGLE(MultiTexCoord3d)
+#define glMultiTexCoord3dvARB MANGLE(MultiTexCoord3dvARB)
+#define glMultiTexCoord3dv MANGLE(MultiTexCoord3dv)
+#define glMultiTexCoord3fARB MANGLE(MultiTexCoord3fARB)
+#define glMultiTexCoord3f MANGLE(MultiTexCoord3f)
+#define glMultiTexCoord3fvARB MANGLE(MultiTexCoord3fvARB)
+#define glMultiTexCoord3fv MANGLE(MultiTexCoord3fv)
+#define glMultiTexCoord3hNV MANGLE(MultiTexCoord3hNV)
+#define glMultiTexCoord3hvNV MANGLE(MultiTexCoord3hvNV)
+#define glMultiTexCoord3iARB MANGLE(MultiTexCoord3iARB)
+#define glMultiTexCoord3i MANGLE(MultiTexCoord3i)
+#define glMultiTexCoord3ivARB MANGLE(MultiTexCoord3ivARB)
+#define glMultiTexCoord3iv MANGLE(MultiTexCoord3iv)
+#define glMultiTexCoord3sARB MANGLE(MultiTexCoord3sARB)
+#define glMultiTexCoord3s MANGLE(MultiTexCoord3s)
+#define glMultiTexCoord3svARB MANGLE(MultiTexCoord3svARB)
+#define glMultiTexCoord3sv MANGLE(MultiTexCoord3sv)
+#define glMultiTexCoord4dARB MANGLE(MultiTexCoord4dARB)
+#define glMultiTexCoord4d MANGLE(MultiTexCoord4d)
+#define glMultiTexCoord4dvARB MANGLE(MultiTexCoord4dvARB)
+#define glMultiTexCoord4dv MANGLE(MultiTexCoord4dv)
+#define glMultiTexCoord4fARB MANGLE(MultiTexCoord4fARB)
+#define glMultiTexCoord4f MANGLE(MultiTexCoord4f)
+#define glMultiTexCoord4fvARB MANGLE(MultiTexCoord4fvARB)
+#define glMultiTexCoord4fv MANGLE(MultiTexCoord4fv)
+#define glMultiTexCoord4hNV MANGLE(MultiTexCoord4hNV)
+#define glMultiTexCoord4hvNV MANGLE(MultiTexCoord4hvNV)
+#define glMultiTexCoord4iARB MANGLE(MultiTexCoord4iARB)
+#define glMultiTexCoord4i MANGLE(MultiTexCoord4i)
+#define glMultiTexCoord4ivARB MANGLE(MultiTexCoord4ivARB)
+#define glMultiTexCoord4iv MANGLE(MultiTexCoord4iv)
+#define glMultiTexCoord4sARB MANGLE(MultiTexCoord4sARB)
+#define glMultiTexCoord4s MANGLE(MultiTexCoord4s)
+#define glMultiTexCoord4svARB MANGLE(MultiTexCoord4svARB)
+#define glMultiTexCoord4sv MANGLE(MultiTexCoord4sv)
+#define glMultMatrixd MANGLE(MultMatrixd)
+#define glMultMatrixf MANGLE(MultMatrixf)
+#define glMultTransposeMatrixdARB MANGLE(MultTransposeMatrixdARB)
+#define glMultTransposeMatrixd MANGLE(MultTransposeMatrixd)
+#define glMultTransposeMatrixfARB MANGLE(MultTransposeMatrixfARB)
+#define glMultTransposeMatrixf MANGLE(MultTransposeMatrixf)
+#define glNewList MANGLE(NewList)
+#define glNewObjectBufferATI MANGLE(NewObjectBufferATI)
+#define glNewTraceMESA MANGLE(NewTraceMESA)
+#define glNormal3b MANGLE(Normal3b)
+#define glNormal3bv MANGLE(Normal3bv)
+#define glNormal3d MANGLE(Normal3d)
+#define glNormal3dv MANGLE(Normal3dv)
+#define glNormal3f MANGLE(Normal3f)
+#define glNormal3fVertex3fSUN MANGLE(Normal3fVertex3fSUN)
+#define glNormal3fVertex3fvSUN MANGLE(Normal3fVertex3fvSUN)
+#define glNormal3fv MANGLE(Normal3fv)
+#define glNormal3hNV MANGLE(Normal3hNV)
+#define glNormal3hvNV MANGLE(Normal3hvNV)
+#define glNormal3i MANGLE(Normal3i)
+#define glNormal3iv MANGLE(Normal3iv)
+#define glNormal3s MANGLE(Normal3s)
+#define glNormal3sv MANGLE(Normal3sv)
+#define glNormalPointerEXT MANGLE(NormalPointerEXT)
+#define glNormalPointerListIBM MANGLE(NormalPointerListIBM)
+#define glNormalPointer MANGLE(NormalPointer)
+#define glNormalPointervINTEL MANGLE(NormalPointervINTEL)
+#define glNormalStream3bATI MANGLE(NormalStream3bATI)
+#define glNormalStream3bvATI MANGLE(NormalStream3bvATI)
+#define glNormalStream3dATI MANGLE(NormalStream3dATI)
+#define glNormalStream3dvATI MANGLE(NormalStream3dvATI)
+#define glNormalStream3fATI MANGLE(NormalStream3fATI)
+#define glNormalStream3fvATI MANGLE(NormalStream3fvATI)
+#define glNormalStream3iATI MANGLE(NormalStream3iATI)
+#define glNormalStream3ivATI MANGLE(NormalStream3ivATI)
+#define glNormalStream3sATI MANGLE(NormalStream3sATI)
+#define glNormalStream3svATI MANGLE(NormalStream3svATI)
+#define glOrtho MANGLE(Ortho)
+#define glPassTexCoordATI MANGLE(PassTexCoordATI)
+#define glPassThrough MANGLE(PassThrough)
+#define glPixelDataRangeNV MANGLE(PixelDataRangeNV)
+#define glPixelMapfv MANGLE(PixelMapfv)
+#define glPixelMapuiv MANGLE(PixelMapuiv)
+#define glPixelMapusv MANGLE(PixelMapusv)
+#define glPixelStoref MANGLE(PixelStoref)
+#define glPixelStorei MANGLE(PixelStorei)
+#define glPixelTexGenParameterfSGIS MANGLE(PixelTexGenParameterfSGIS)
+#define glPixelTexGenParameterfvSGIS MANGLE(PixelTexGenParameterfvSGIS)
+#define glPixelTexGenParameteriSGIS MANGLE(PixelTexGenParameteriSGIS)
+#define glPixelTexGenParameterivSGIS MANGLE(PixelTexGenParameterivSGIS)
+#define glPixelTexGenSGIX MANGLE(PixelTexGenSGIX)
+#define glPixelTransferf MANGLE(PixelTransferf)
+#define glPixelTransferi MANGLE(PixelTransferi)
+#define glPixelTransformParameterfEXT MANGLE(PixelTransformParameterfEXT)
+#define glPixelTransformParameterfvEXT MANGLE(PixelTransformParameterfvEXT)
+#define glPixelTransformParameteriEXT MANGLE(PixelTransformParameteriEXT)
+#define glPixelTransformParameterivEXT MANGLE(PixelTransformParameterivEXT)
+#define glPixelZoom MANGLE(PixelZoom)
+#define glPNTrianglesfATI MANGLE(PNTrianglesfATI)
+#define glPNTrianglesiATI MANGLE(PNTrianglesiATI)
+#define glPointParameterfARB MANGLE(PointParameterfARB)
+#define glPointParameterfEXT MANGLE(PointParameterfEXT)
+#define glPointParameterf MANGLE(PointParameterf)
+#define glPointParameterfSGIS MANGLE(PointParameterfSGIS)
+#define glPointParameterfvARB MANGLE(PointParameterfvARB)
+#define glPointParameterfvEXT MANGLE(PointParameterfvEXT)
+#define glPointParameterfv MANGLE(PointParameterfv)
+#define glPointParameterfvSGIS MANGLE(PointParameterfvSGIS)
+#define glPointParameteri MANGLE(PointParameteri)
+#define glPointParameteriNV MANGLE(PointParameteriNV)
+#define glPointParameteriv MANGLE(PointParameteriv)
+#define glPointParameterivNV MANGLE(PointParameterivNV)
+#define glPointSize MANGLE(PointSize)
+#define glPollAsyncSGIX MANGLE(PollAsyncSGIX)
+#define glPollInstrumentsSGIX MANGLE(PollInstrumentsSGIX)
+#define glPolygonMode MANGLE(PolygonMode)
+#define glPolygonOffsetEXT MANGLE(PolygonOffsetEXT)
+#define glPolygonOffset MANGLE(PolygonOffset)
+#define glPolygonStipple MANGLE(PolygonStipple)
+#define glPopAttrib MANGLE(PopAttrib)
+#define glPopClientAttrib MANGLE(PopClientAttrib)
+#define glPopMatrix MANGLE(PopMatrix)
+#define glPopName MANGLE(PopName)
+#define glPrimitiveRestartIndexNV MANGLE(PrimitiveRestartIndexNV)
+#define glPrimitiveRestartNV MANGLE(PrimitiveRestartNV)
+#define glPrioritizeTexturesEXT MANGLE(PrioritizeTexturesEXT)
+#define glPrioritizeTextures MANGLE(PrioritizeTextures)
+#define glProgramCallbackMESA MANGLE(ProgramCallbackMESA)
+#define glProgramEnvParameter4dARB MANGLE(ProgramEnvParameter4dARB)
+#define glProgramEnvParameter4dvARB MANGLE(ProgramEnvParameter4dvARB)
+#define glProgramEnvParameter4fARB MANGLE(ProgramEnvParameter4fARB)
+#define glProgramEnvParameter4fvARB MANGLE(ProgramEnvParameter4fvARB)
+#define glProgramEnvParameters4fvEXT MANGLE(ProgramEnvParameters4fvEXT)
+#define glProgramLocalParameter4dARB MANGLE(ProgramLocalParameter4dARB)
+#define glProgramLocalParameter4dvARB MANGLE(ProgramLocalParameter4dvARB)
+#define glProgramLocalParameter4fARB MANGLE(ProgramLocalParameter4fARB)
+#define glProgramLocalParameter4fvARB MANGLE(ProgramLocalParameter4fvARB)
+#define glProgramLocalParameters4fvEXT MANGLE(ProgramLocalParameters4fvEXT)
+#define glProgramNamedParameter4dNV MANGLE(ProgramNamedParameter4dNV)
+#define glProgramNamedParameter4dvNV MANGLE(ProgramNamedParameter4dvNV)
+#define glProgramNamedParameter4fNV MANGLE(ProgramNamedParameter4fNV)
+#define glProgramNamedParameter4fvNV MANGLE(ProgramNamedParameter4fvNV)
+#define glProgramParameter4dNV MANGLE(ProgramParameter4dNV)
+#define glProgramParameter4dvNV MANGLE(ProgramParameter4dvNV)
+#define glProgramParameter4fNV MANGLE(ProgramParameter4fNV)
+#define glProgramParameter4fvNV MANGLE(ProgramParameter4fvNV)
+#define glProgramParameters4dvNV MANGLE(ProgramParameters4dvNV)
+#define glProgramParameters4fvNV MANGLE(ProgramParameters4fvNV)
+#define glProgramStringARB MANGLE(ProgramStringARB)
+#define glPushAttrib MANGLE(PushAttrib)
+#define glPushClientAttrib MANGLE(PushClientAttrib)
+#define glPushMatrix MANGLE(PushMatrix)
+#define glPushName MANGLE(PushName)
+#define glRasterPos2d MANGLE(RasterPos2d)
+#define glRasterPos2dv MANGLE(RasterPos2dv)
+#define glRasterPos2f MANGLE(RasterPos2f)
+#define glRasterPos2fv MANGLE(RasterPos2fv)
+#define glRasterPos2i MANGLE(RasterPos2i)
+#define glRasterPos2iv MANGLE(RasterPos2iv)
+#define glRasterPos2s MANGLE(RasterPos2s)
+#define glRasterPos2sv MANGLE(RasterPos2sv)
+#define glRasterPos3d MANGLE(RasterPos3d)
+#define glRasterPos3dv MANGLE(RasterPos3dv)
+#define glRasterPos3f MANGLE(RasterPos3f)
+#define glRasterPos3fv MANGLE(RasterPos3fv)
+#define glRasterPos3i MANGLE(RasterPos3i)
+#define glRasterPos3iv MANGLE(RasterPos3iv)
+#define glRasterPos3s MANGLE(RasterPos3s)
+#define glRasterPos3sv MANGLE(RasterPos3sv)
+#define glRasterPos4d MANGLE(RasterPos4d)
+#define glRasterPos4dv MANGLE(RasterPos4dv)
+#define glRasterPos4f MANGLE(RasterPos4f)
+#define glRasterPos4fv MANGLE(RasterPos4fv)
+#define glRasterPos4i MANGLE(RasterPos4i)
+#define glRasterPos4iv MANGLE(RasterPos4iv)
+#define glRasterPos4s MANGLE(RasterPos4s)
+#define glRasterPos4sv MANGLE(RasterPos4sv)
+#define glReadBuffer MANGLE(ReadBuffer)
+#define glReadInstrumentsSGIX MANGLE(ReadInstrumentsSGIX)
+#define glReadPixels MANGLE(ReadPixels)
+#define glRectd MANGLE(Rectd)
+#define glRectdv MANGLE(Rectdv)
+#define glRectf MANGLE(Rectf)
+#define glRectfv MANGLE(Rectfv)
+#define glRecti MANGLE(Recti)
+#define glRectiv MANGLE(Rectiv)
+#define glRects MANGLE(Rects)
+#define glRectsv MANGLE(Rectsv)
+#define glReferencePlaneSGIX MANGLE(ReferencePlaneSGIX)
+#define glRenderbufferStorageEXT MANGLE(RenderbufferStorageEXT)
+#define glRenderMode MANGLE(RenderMode)
+#define glReplacementCodePointerSUN MANGLE(ReplacementCodePointerSUN)
+#define glReplacementCodeubSUN MANGLE(ReplacementCodeubSUN)
+#define glReplacementCodeubvSUN MANGLE(ReplacementCodeubvSUN)
+#define glReplacementCodeuiColor3fVertex3fSUN MANGLE(ReplacementCodeuiColor3fVertex3fSUN)
+#define glReplacementCodeuiColor3fVertex3fvSUN MANGLE(ReplacementCodeuiColor3fVertex3fvSUN)
+#define glReplacementCodeuiColor4fNormal3fVertex3fSUN MANGLE(ReplacementCodeuiColor4fNormal3fVertex3fSUN)
+#define glReplacementCodeuiColor4fNormal3fVertex3fvSUN MANGLE(ReplacementCodeuiColor4fNormal3fVertex3fvSUN)
+#define glReplacementCodeuiColor4ubVertex3fSUN MANGLE(ReplacementCodeuiColor4ubVertex3fSUN)
+#define glReplacementCodeuiColor4ubVertex3fvSUN MANGLE(ReplacementCodeuiColor4ubVertex3fvSUN)
+#define glReplacementCodeuiNormal3fVertex3fSUN MANGLE(ReplacementCodeuiNormal3fVertex3fSUN)
+#define glReplacementCodeuiNormal3fVertex3fvSUN MANGLE(ReplacementCodeuiNormal3fVertex3fvSUN)
+#define glReplacementCodeuiSUN MANGLE(ReplacementCodeuiSUN)
+#define glReplacementCodeuiTexCoord2fColor4fNormal3fVertex3fSUN MANGLE(ReplacementCodeuiTexCoord2fColor4fNormal3fVertex3fSUN)
+#define glReplacementCodeuiTexCoord2fColor4fNormal3fVertex3fvSUN MANGLE(ReplacementCodeuiTexCoord2fColor4fNormal3fVertex3fvSUN)
+#define glReplacementCodeuiTexCoord2fNormal3fVertex3fSUN MANGLE(ReplacementCodeuiTexCoord2fNormal3fVertex3fSUN)
+#define glReplacementCodeuiTexCoord2fNormal3fVertex3fvSUN MANGLE(ReplacementCodeuiTexCoord2fNormal3fVertex3fvSUN)
+#define glReplacementCodeuiTexCoord2fVertex3fSUN MANGLE(ReplacementCodeuiTexCoord2fVertex3fSUN)
+#define glReplacementCodeuiTexCoord2fVertex3fvSUN MANGLE(ReplacementCodeuiTexCoord2fVertex3fvSUN)
+#define glReplacementCodeuiVertex3fSUN MANGLE(ReplacementCodeuiVertex3fSUN)
+#define glReplacementCodeuiVertex3fvSUN MANGLE(ReplacementCodeuiVertex3fvSUN)
+#define glReplacementCodeuivSUN MANGLE(ReplacementCodeuivSUN)
+#define glReplacementCodeusSUN MANGLE(ReplacementCodeusSUN)
+#define glReplacementCodeusvSUN MANGLE(ReplacementCodeusvSUN)
+#define glRequestResidentProgramsNV MANGLE(RequestResidentProgramsNV)
+#define glResetHistogramEXT MANGLE(ResetHistogramEXT)
+#define glResetHistogram MANGLE(ResetHistogram)
+#define glResetMinmaxEXT MANGLE(ResetMinmaxEXT)
+#define glResetMinmax MANGLE(ResetMinmax)
+#define glResizeBuffersMESA MANGLE(ResizeBuffersMESA)
+#define glRotated MANGLE(Rotated)
+#define glRotatef MANGLE(Rotatef)
+#define glSampleCoverageARB MANGLE(SampleCoverageARB)
+#define glSampleCoverage MANGLE(SampleCoverage)
+#define glSampleMapATI MANGLE(SampleMapATI)
+#define glSampleMaskEXT MANGLE(SampleMaskEXT)
+#define glSampleMaskSGIS MANGLE(SampleMaskSGIS)
+#define glSamplePatternEXT MANGLE(SamplePatternEXT)
+#define glSamplePatternSGIS MANGLE(SamplePatternSGIS)
+#define glScaled MANGLE(Scaled)
+#define glScalef MANGLE(Scalef)
+#define glScissor MANGLE(Scissor)
+#define glSecondaryColor3bEXT MANGLE(SecondaryColor3bEXT)
+#define glSecondaryColor3b MANGLE(SecondaryColor3b)
+#define glSecondaryColor3bvEXT MANGLE(SecondaryColor3bvEXT)
+#define glSecondaryColor3bv MANGLE(SecondaryColor3bv)
+#define glSecondaryColor3dEXT MANGLE(SecondaryColor3dEXT)
+#define glSecondaryColor3d MANGLE(SecondaryColor3d)
+#define glSecondaryColor3dvEXT MANGLE(SecondaryColor3dvEXT)
+#define glSecondaryColor3dv MANGLE(SecondaryColor3dv)
+#define glSecondaryColor3fEXT MANGLE(SecondaryColor3fEXT)
+#define glSecondaryColor3f MANGLE(SecondaryColor3f)
+#define glSecondaryColor3fvEXT MANGLE(SecondaryColor3fvEXT)
+#define glSecondaryColor3fv MANGLE(SecondaryColor3fv)
+#define glSecondaryColor3hNV MANGLE(SecondaryColor3hNV)
+#define glSecondaryColor3hvNV MANGLE(SecondaryColor3hvNV)
+#define glSecondaryColor3iEXT MANGLE(SecondaryColor3iEXT)
+#define glSecondaryColor3i MANGLE(SecondaryColor3i)
+#define glSecondaryColor3ivEXT MANGLE(SecondaryColor3ivEXT)
+#define glSecondaryColor3iv MANGLE(SecondaryColor3iv)
+#define glSecondaryColor3sEXT MANGLE(SecondaryColor3sEXT)
+#define glSecondaryColor3s MANGLE(SecondaryColor3s)
+#define glSecondaryColor3svEXT MANGLE(SecondaryColor3svEXT)
+#define glSecondaryColor3sv MANGLE(SecondaryColor3sv)
+#define glSecondaryColor3ubEXT MANGLE(SecondaryColor3ubEXT)
+#define glSecondaryColor3ub MANGLE(SecondaryColor3ub)
+#define glSecondaryColor3ubvEXT MANGLE(SecondaryColor3ubvEXT)
+#define glSecondaryColor3ubv MANGLE(SecondaryColor3ubv)
+#define glSecondaryColor3uiEXT MANGLE(SecondaryColor3uiEXT)
+#define glSecondaryColor3ui MANGLE(SecondaryColor3ui)
+#define glSecondaryColor3uivEXT MANGLE(SecondaryColor3uivEXT)
+#define glSecondaryColor3uiv MANGLE(SecondaryColor3uiv)
+#define glSecondaryColor3usEXT MANGLE(SecondaryColor3usEXT)
+#define glSecondaryColor3us MANGLE(SecondaryColor3us)
+#define glSecondaryColor3usvEXT MANGLE(SecondaryColor3usvEXT)
+#define glSecondaryColor3usv MANGLE(SecondaryColor3usv)
+#define glSecondaryColorPointerEXT MANGLE(SecondaryColorPointerEXT)
+#define glSecondaryColorPointerListIBM MANGLE(SecondaryColorPointerListIBM)
+#define glSecondaryColorPointer MANGLE(SecondaryColorPointer)
+#define glSelectBuffer MANGLE(SelectBuffer)
+#define glSeparableFilter2DEXT MANGLE(SeparableFilter2DEXT)
+#define glSeparableFilter2D MANGLE(SeparableFilter2D)
+#define glSetFenceAPPLE MANGLE(SetFenceAPPLE)
+#define glSetFenceNV MANGLE(SetFenceNV)
+#define glSetFragmentShaderConstantATI MANGLE(SetFragmentShaderConstantATI)
+#define glSetInvariantEXT MANGLE(SetInvariantEXT)
+#define glSetLocalConstantEXT MANGLE(SetLocalConstantEXT)
+#define glShadeModel MANGLE(ShadeModel)
+#define glShaderOp1EXT MANGLE(ShaderOp1EXT)
+#define glShaderOp2EXT MANGLE(ShaderOp2EXT)
+#define glShaderOp3EXT MANGLE(ShaderOp3EXT)
+#define glShaderSourceARB MANGLE(ShaderSourceARB)
+#define glShaderSource MANGLE(ShaderSource)
+#define glSharpenTexFuncSGIS MANGLE(SharpenTexFuncSGIS)
+#define glSpriteParameterfSGIX MANGLE(SpriteParameterfSGIX)
+#define glSpriteParameterfvSGIX MANGLE(SpriteParameterfvSGIX)
+#define glSpriteParameteriSGIX MANGLE(SpriteParameteriSGIX)
+#define glSpriteParameterivSGIX MANGLE(SpriteParameterivSGIX)
+#define glStartInstrumentsSGIX MANGLE(StartInstrumentsSGIX)
+#define glStencilFunc MANGLE(StencilFunc)
+#define glStencilFuncSeparateATI MANGLE(StencilFuncSeparateATI)
+#define glStencilFuncSeparate MANGLE(StencilFuncSeparate)
+#define glStencilMask MANGLE(StencilMask)
+#define glStencilMaskSeparate MANGLE(StencilMaskSeparate)
+#define glStencilOp MANGLE(StencilOp)
+#define glStencilOpSeparateATI MANGLE(StencilOpSeparateATI)
+#define glStencilOpSeparate MANGLE(StencilOpSeparate)
+#define glStopInstrumentsSGIX MANGLE(StopInstrumentsSGIX)
+#define glStringMarkerGREMEDY MANGLE(StringMarkerGREMEDY)
+#define glSwizzleEXT MANGLE(SwizzleEXT)
+#define glTagSampleBufferSGIX MANGLE(TagSampleBufferSGIX)
+#define glTangent3bEXT MANGLE(Tangent3bEXT)
+#define glTangent3bvEXT MANGLE(Tangent3bvEXT)
+#define glTangent3dEXT MANGLE(Tangent3dEXT)
+#define glTangent3dvEXT MANGLE(Tangent3dvEXT)
+#define glTangent3fEXT MANGLE(Tangent3fEXT)
+#define glTangent3fvEXT MANGLE(Tangent3fvEXT)
+#define glTangent3iEXT MANGLE(Tangent3iEXT)
+#define glTangent3ivEXT MANGLE(Tangent3ivEXT)
+#define glTangent3sEXT MANGLE(Tangent3sEXT)
+#define glTangent3svEXT MANGLE(Tangent3svEXT)
+#define glTangentPointerEXT MANGLE(TangentPointerEXT)
+#define glTbufferMask3DFX MANGLE(TbufferMask3DFX)
+#define glTestFenceAPPLE MANGLE(TestFenceAPPLE)
+#define glTestFenceNV MANGLE(TestFenceNV)
+#define glTestObjectAPPLE MANGLE(TestObjectAPPLE)
+#define glTexBumpParameterfvATI MANGLE(TexBumpParameterfvATI)
+#define glTexBumpParameterivATI MANGLE(TexBumpParameterivATI)
+#define glTexCoord1d MANGLE(TexCoord1d)
+#define glTexCoord1dv MANGLE(TexCoord1dv)
+#define glTexCoord1f MANGLE(TexCoord1f)
+#define glTexCoord1fv MANGLE(TexCoord1fv)
+#define glTexCoord1hNV MANGLE(TexCoord1hNV)
+#define glTexCoord1hvNV MANGLE(TexCoord1hvNV)
+#define glTexCoord1i MANGLE(TexCoord1i)
+#define glTexCoord1iv MANGLE(TexCoord1iv)
+#define glTexCoord1s MANGLE(TexCoord1s)
+#define glTexCoord1sv MANGLE(TexCoord1sv)
+#define glTexCoord2d MANGLE(TexCoord2d)
+#define glTexCoord2dv MANGLE(TexCoord2dv)
+#define glTexCoord2fColor3fVertex3fSUN MANGLE(TexCoord2fColor3fVertex3fSUN)
+#define glTexCoord2fColor3fVertex3fvSUN MANGLE(TexCoord2fColor3fVertex3fvSUN)
+#define glTexCoord2fColor4fNormal3fVertex3fSUN MANGLE(TexCoord2fColor4fNormal3fVertex3fSUN)
+#define glTexCoord2fColor4fNormal3fVertex3fvSUN MANGLE(TexCoord2fColor4fNormal3fVertex3fvSUN)
+#define glTexCoord2fColor4ubVertex3fSUN MANGLE(TexCoord2fColor4ubVertex3fSUN)
+#define glTexCoord2fColor4ubVertex3fvSUN MANGLE(TexCoord2fColor4ubVertex3fvSUN)
+#define glTexCoord2f MANGLE(TexCoord2f)
+#define glTexCoord2fNormal3fVertex3fSUN MANGLE(TexCoord2fNormal3fVertex3fSUN)
+#define glTexCoord2fNormal3fVertex3fvSUN MANGLE(TexCoord2fNormal3fVertex3fvSUN)
+#define glTexCoord2fVertex3fSUN MANGLE(TexCoord2fVertex3fSUN)
+#define glTexCoord2fVertex3fvSUN MANGLE(TexCoord2fVertex3fvSUN)
+#define glTexCoord2fv MANGLE(TexCoord2fv)
+#define glTexCoord2hNV MANGLE(TexCoord2hNV)
+#define glTexCoord2hvNV MANGLE(TexCoord2hvNV)
+#define glTexCoord2i MANGLE(TexCoord2i)
+#define glTexCoord2iv MANGLE(TexCoord2iv)
+#define glTexCoord2s MANGLE(TexCoord2s)
+#define glTexCoord2sv MANGLE(TexCoord2sv)
+#define glTexCoord3d MANGLE(TexCoord3d)
+#define glTexCoord3dv MANGLE(TexCoord3dv)
+#define glTexCoord3f MANGLE(TexCoord3f)
+#define glTexCoord3fv MANGLE(TexCoord3fv)
+#define glTexCoord3hNV MANGLE(TexCoord3hNV)
+#define glTexCoord3hvNV MANGLE(TexCoord3hvNV)
+#define glTexCoord3i MANGLE(TexCoord3i)
+#define glTexCoord3iv MANGLE(TexCoord3iv)
+#define glTexCoord3s MANGLE(TexCoord3s)
+#define glTexCoord3sv MANGLE(TexCoord3sv)
+#define glTexCoord4d MANGLE(TexCoord4d)
+#define glTexCoord4dv MANGLE(TexCoord4dv)
+#define glTexCoord4fColor4fNormal3fVertex4fSUN MANGLE(TexCoord4fColor4fNormal3fVertex4fSUN)
+#define glTexCoord4fColor4fNormal3fVertex4fvSUN MANGLE(TexCoord4fColor4fNormal3fVertex4fvSUN)
+#define glTexCoord4f MANGLE(TexCoord4f)
+#define glTexCoord4fVertex4fSUN MANGLE(TexCoord4fVertex4fSUN)
+#define glTexCoord4fVertex4fvSUN MANGLE(TexCoord4fVertex4fvSUN)
+#define glTexCoord4fv MANGLE(TexCoord4fv)
+#define glTexCoord4hNV MANGLE(TexCoord4hNV)
+#define glTexCoord4hvNV MANGLE(TexCoord4hvNV)
+#define glTexCoord4i MANGLE(TexCoord4i)
+#define glTexCoord4iv MANGLE(TexCoord4iv)
+#define glTexCoord4s MANGLE(TexCoord4s)
+#define glTexCoord4sv MANGLE(TexCoord4sv)
+#define glTexCoordPointerEXT MANGLE(TexCoordPointerEXT)
+#define glTexCoordPointerListIBM MANGLE(TexCoordPointerListIBM)
+#define glTexCoordPointer MANGLE(TexCoordPointer)
+#define glTexCoordPointervINTEL MANGLE(TexCoordPointervINTEL)
+#define glTexEnvf MANGLE(TexEnvf)
+#define glTexEnvfv MANGLE(TexEnvfv)
+#define glTexEnvi MANGLE(TexEnvi)
+#define glTexEnviv MANGLE(TexEnviv)
+#define glTexFilterFuncSGIS MANGLE(TexFilterFuncSGIS)
+#define glTexGend MANGLE(TexGend)
+#define glTexGendv MANGLE(TexGendv)
+#define glTexGenf MANGLE(TexGenf)
+#define glTexGenfv MANGLE(TexGenfv)
+#define glTexGeni MANGLE(TexGeni)
+#define glTexGeniv MANGLE(TexGeniv)
+#define glTexImage1D MANGLE(TexImage1D)
+#define glTexImage2D MANGLE(TexImage2D)
+#define glTexImage3DEXT MANGLE(TexImage3DEXT)
+#define glTexImage3D MANGLE(TexImage3D)
+#define glTexImage4DSGIS MANGLE(TexImage4DSGIS)
+#define glTexParameterf MANGLE(TexParameterf)
+#define glTexParameterfv MANGLE(TexParameterfv)
+#define glTexParameteri MANGLE(TexParameteri)
+#define glTexParameteriv MANGLE(TexParameteriv)
+#define glTexSubImage1DEXT MANGLE(TexSubImage1DEXT)
+#define glTexSubImage1D MANGLE(TexSubImage1D)
+#define glTexSubImage2DEXT MANGLE(TexSubImage2DEXT)
+#define glTexSubImage2D MANGLE(TexSubImage2D)
+#define glTexSubImage3DEXT MANGLE(TexSubImage3DEXT)
+#define glTexSubImage3D MANGLE(TexSubImage3D)
+#define glTexSubImage4DSGIS MANGLE(TexSubImage4DSGIS)
+#define glTextureColorMaskSGIS MANGLE(TextureColorMaskSGIS)
+#define glTextureLightEXT MANGLE(TextureLightEXT)
+#define glTextureMaterialEXT MANGLE(TextureMaterialEXT)
+#define glTextureNormalEXT MANGLE(TextureNormalEXT)
+#define glTraceAssertAttribMESA MANGLE(TraceAssertAttribMESA)
+#define glTraceCommentMESA MANGLE(TraceCommentMESA)
+#define glTraceListMESA MANGLE(TraceListMESA)
+#define glTracePointerMESA MANGLE(TracePointerMESA)
+#define glTracePointerRangeMESA MANGLE(TracePointerRangeMESA)
+#define glTraceTextureMESA MANGLE(TraceTextureMESA)
+#define glTrackMatrixNV MANGLE(TrackMatrixNV)
+#define glTranslated MANGLE(Translated)
+#define glTranslatef MANGLE(Translatef)
+#define glUniform1fARB MANGLE(Uniform1fARB)
+#define glUniform1f MANGLE(Uniform1f)
+#define glUniform1fvARB MANGLE(Uniform1fvARB)
+#define glUniform1fv MANGLE(Uniform1fv)
+#define glUniform1iARB MANGLE(Uniform1iARB)
+#define glUniform1i MANGLE(Uniform1i)
+#define glUniform1ivARB MANGLE(Uniform1ivARB)
+#define glUniform1iv MANGLE(Uniform1iv)
+#define glUniform2fARB MANGLE(Uniform2fARB)
+#define glUniform2f MANGLE(Uniform2f)
+#define glUniform2fvARB MANGLE(Uniform2fvARB)
+#define glUniform2fv MANGLE(Uniform2fv)
+#define glUniform2iARB MANGLE(Uniform2iARB)
+#define glUniform2i MANGLE(Uniform2i)
+#define glUniform2ivARB MANGLE(Uniform2ivARB)
+#define glUniform2iv MANGLE(Uniform2iv)
+#define glUniform3fARB MANGLE(Uniform3fARB)
+#define glUniform3f MANGLE(Uniform3f)
+#define glUniform3fvARB MANGLE(Uniform3fvARB)
+#define glUniform3fv MANGLE(Uniform3fv)
+#define glUniform3iARB MANGLE(Uniform3iARB)
+#define glUniform3i MANGLE(Uniform3i)
+#define glUniform3ivARB MANGLE(Uniform3ivARB)
+#define glUniform3iv MANGLE(Uniform3iv)
+#define glUniform4fARB MANGLE(Uniform4fARB)
+#define glUniform4f MANGLE(Uniform4f)
+#define glUniform4fvARB MANGLE(Uniform4fvARB)
+#define glUniform4fv MANGLE(Uniform4fv)
+#define glUniform4iARB MANGLE(Uniform4iARB)
+#define glUniform4i MANGLE(Uniform4i)
+#define glUniform4ivARB MANGLE(Uniform4ivARB)
+#define glUniform4iv MANGLE(Uniform4iv)
+#define glUniformMatrix2fvARB MANGLE(UniformMatrix2fvARB)
+#define glUniformMatrix2fv MANGLE(UniformMatrix2fv)
+#define glUniformMatrix3fvARB MANGLE(UniformMatrix3fvARB)
+#define glUniformMatrix3fv MANGLE(UniformMatrix3fv)
+#define glUniformMatrix4fvARB MANGLE(UniformMatrix4fvARB)
+#define glUniformMatrix4fv MANGLE(UniformMatrix4fv)
+#define glUnlockArraysEXT MANGLE(UnlockArraysEXT)
+#define glUnmapBufferARB MANGLE(UnmapBufferARB)
+#define glUnmapBuffer MANGLE(UnmapBuffer)
+#define glUnmapObjectBufferATI MANGLE(UnmapObjectBufferATI)
+#define glUpdateObjectBufferATI MANGLE(UpdateObjectBufferATI)
+#define glUseProgram MANGLE(UseProgram)
+#define glUseProgramObjectARB MANGLE(UseProgramObjectARB)
+#define glValidateProgramARB MANGLE(ValidateProgramARB)
+#define glValidateProgram MANGLE(ValidateProgram)
+#define glVariantArrayObjectATI MANGLE(VariantArrayObjectATI)
+#define glVariantbvEXT MANGLE(VariantbvEXT)
+#define glVariantdvEXT MANGLE(VariantdvEXT)
+#define glVariantfvEXT MANGLE(VariantfvEXT)
+#define glVariantivEXT MANGLE(VariantivEXT)
+#define glVariantPointerEXT MANGLE(VariantPointerEXT)
+#define glVariantsvEXT MANGLE(VariantsvEXT)
+#define glVariantubvEXT MANGLE(VariantubvEXT)
+#define glVariantuivEXT MANGLE(VariantuivEXT)
+#define glVariantusvEXT MANGLE(VariantusvEXT)
+#define glVertex2d MANGLE(Vertex2d)
+#define glVertex2dv MANGLE(Vertex2dv)
+#define glVertex2f MANGLE(Vertex2f)
+#define glVertex2fv MANGLE(Vertex2fv)
+#define glVertex2hNV MANGLE(Vertex2hNV)
+#define glVertex2hvNV MANGLE(Vertex2hvNV)
+#define glVertex2i MANGLE(Vertex2i)
+#define glVertex2iv MANGLE(Vertex2iv)
+#define glVertex2s MANGLE(Vertex2s)
+#define glVertex2sv MANGLE(Vertex2sv)
+#define glVertex3d MANGLE(Vertex3d)
+#define glVertex3dv MANGLE(Vertex3dv)
+#define glVertex3f MANGLE(Vertex3f)
+#define glVertex3fv MANGLE(Vertex3fv)
+#define glVertex3hNV MANGLE(Vertex3hNV)
+#define glVertex3hvNV MANGLE(Vertex3hvNV)
+#define glVertex3i MANGLE(Vertex3i)
+#define glVertex3iv MANGLE(Vertex3iv)
+#define glVertex3s MANGLE(Vertex3s)
+#define glVertex3sv MANGLE(Vertex3sv)
+#define glVertex4d MANGLE(Vertex4d)
+#define glVertex4dv MANGLE(Vertex4dv)
+#define glVertex4f MANGLE(Vertex4f)
+#define glVertex4fv MANGLE(Vertex4fv)
+#define glVertex4hNV MANGLE(Vertex4hNV)
+#define glVertex4hvNV MANGLE(Vertex4hvNV)
+#define glVertex4i MANGLE(Vertex4i)
+#define glVertex4iv MANGLE(Vertex4iv)
+#define glVertex4s MANGLE(Vertex4s)
+#define glVertex4sv MANGLE(Vertex4sv)
+#define glVertexArrayParameteriAPPLE MANGLE(VertexArrayParameteriAPPLE)
+#define glVertexArrayRangeAPPLE MANGLE(VertexArrayRangeAPPLE)
+#define glVertexArrayRangeNV MANGLE(VertexArrayRangeNV)
+#define glVertexAttrib1dARB MANGLE(VertexAttrib1dARB)
+#define glVertexAttrib1d MANGLE(VertexAttrib1d)
+#define glVertexAttrib1dNV MANGLE(VertexAttrib1dNV)
+#define glVertexAttrib1dvARB MANGLE(VertexAttrib1dvARB)
+#define glVertexAttrib1dv MANGLE(VertexAttrib1dv)
+#define glVertexAttrib1dvNV MANGLE(VertexAttrib1dvNV)
+#define glVertexAttrib1fARB MANGLE(VertexAttrib1fARB)
+#define glVertexAttrib1f MANGLE(VertexAttrib1f)
+#define glVertexAttrib1fNV MANGLE(VertexAttrib1fNV)
+#define glVertexAttrib1fvARB MANGLE(VertexAttrib1fvARB)
+#define glVertexAttrib1fv MANGLE(VertexAttrib1fv)
+#define glVertexAttrib1fvNV MANGLE(VertexAttrib1fvNV)
+#define glVertexAttrib1hNV MANGLE(VertexAttrib1hNV)
+#define glVertexAttrib1hvNV MANGLE(VertexAttrib1hvNV)
+#define glVertexAttrib1sARB MANGLE(VertexAttrib1sARB)
+#define glVertexAttrib1s MANGLE(VertexAttrib1s)
+#define glVertexAttrib1sNV MANGLE(VertexAttrib1sNV)
+#define glVertexAttrib1svARB MANGLE(VertexAttrib1svARB)
+#define glVertexAttrib1sv MANGLE(VertexAttrib1sv)
+#define glVertexAttrib1svNV MANGLE(VertexAttrib1svNV)
+#define glVertexAttrib2dARB MANGLE(VertexAttrib2dARB)
+#define glVertexAttrib2d MANGLE(VertexAttrib2d)
+#define glVertexAttrib2dNV MANGLE(VertexAttrib2dNV)
+#define glVertexAttrib2dvARB MANGLE(VertexAttrib2dvARB)
+#define glVertexAttrib2dv MANGLE(VertexAttrib2dv)
+#define glVertexAttrib2dvNV MANGLE(VertexAttrib2dvNV)
+#define glVertexAttrib2fARB MANGLE(VertexAttrib2fARB)
+#define glVertexAttrib2f MANGLE(VertexAttrib2f)
+#define glVertexAttrib2fNV MANGLE(VertexAttrib2fNV)
+#define glVertexAttrib2fvARB MANGLE(VertexAttrib2fvARB)
+#define glVertexAttrib2fv MANGLE(VertexAttrib2fv)
+#define glVertexAttrib2fvNV MANGLE(VertexAttrib2fvNV)
+#define glVertexAttrib2hNV MANGLE(VertexAttrib2hNV)
+#define glVertexAttrib2hvNV MANGLE(VertexAttrib2hvNV)
+#define glVertexAttrib2sARB MANGLE(VertexAttrib2sARB)
+#define glVertexAttrib2s MANGLE(VertexAttrib2s)
+#define glVertexAttrib2sNV MANGLE(VertexAttrib2sNV)
+#define glVertexAttrib2svARB MANGLE(VertexAttrib2svARB)
+#define glVertexAttrib2sv MANGLE(VertexAttrib2sv)
+#define glVertexAttrib2svNV MANGLE(VertexAttrib2svNV)
+#define glVertexAttrib3dARB MANGLE(VertexAttrib3dARB)
+#define glVertexAttrib3d MANGLE(VertexAttrib3d)
+#define glVertexAttrib3dNV MANGLE(VertexAttrib3dNV)
+#define glVertexAttrib3dvARB MANGLE(VertexAttrib3dvARB)
+#define glVertexAttrib3dv MANGLE(VertexAttrib3dv)
+#define glVertexAttrib3dvNV MANGLE(VertexAttrib3dvNV)
+#define glVertexAttrib3fARB MANGLE(VertexAttrib3fARB)
+#define glVertexAttrib3f MANGLE(VertexAttrib3f)
+#define glVertexAttrib3fNV MANGLE(VertexAttrib3fNV)
+#define glVertexAttrib3fvARB MANGLE(VertexAttrib3fvARB)
+#define glVertexAttrib3fv MANGLE(VertexAttrib3fv)
+#define glVertexAttrib3fvNV MANGLE(VertexAttrib3fvNV)
+#define glVertexAttrib3hNV MANGLE(VertexAttrib3hNV)
+#define glVertexAttrib3hvNV MANGLE(VertexAttrib3hvNV)
+#define glVertexAttrib3sARB MANGLE(VertexAttrib3sARB)
+#define glVertexAttrib3s MANGLE(VertexAttrib3s)
+#define glVertexAttrib3sNV MANGLE(VertexAttrib3sNV)
+#define glVertexAttrib3svARB MANGLE(VertexAttrib3svARB)
+#define glVertexAttrib3sv MANGLE(VertexAttrib3sv)
+#define glVertexAttrib3svNV MANGLE(VertexAttrib3svNV)
+#define glVertexAttrib4bvARB MANGLE(VertexAttrib4bvARB)
+#define glVertexAttrib4bv MANGLE(VertexAttrib4bv)
+#define glVertexAttrib4dARB MANGLE(VertexAttrib4dARB)
+#define glVertexAttrib4d MANGLE(VertexAttrib4d)
+#define glVertexAttrib4dNV MANGLE(VertexAttrib4dNV)
+#define glVertexAttrib4dvARB MANGLE(VertexAttrib4dvARB)
+#define glVertexAttrib4dv MANGLE(VertexAttrib4dv)
+#define glVertexAttrib4dvNV MANGLE(VertexAttrib4dvNV)
+#define glVertexAttrib4fARB MANGLE(VertexAttrib4fARB)
+#define glVertexAttrib4f MANGLE(VertexAttrib4f)
+#define glVertexAttrib4fNV MANGLE(VertexAttrib4fNV)
+#define glVertexAttrib4fvARB MANGLE(VertexAttrib4fvARB)
+#define glVertexAttrib4fv MANGLE(VertexAttrib4fv)
+#define glVertexAttrib4fvNV MANGLE(VertexAttrib4fvNV)
+#define glVertexAttrib4hNV MANGLE(VertexAttrib4hNV)
+#define glVertexAttrib4hvNV MANGLE(VertexAttrib4hvNV)
+#define glVertexAttrib4ivARB MANGLE(VertexAttrib4ivARB)
+#define glVertexAttrib4iv MANGLE(VertexAttrib4iv)
+#define glVertexAttrib4NbvARB MANGLE(VertexAttrib4NbvARB)
+#define glVertexAttrib4Nbv MANGLE(VertexAttrib4Nbv)
+#define glVertexAttrib4NivARB MANGLE(VertexAttrib4NivARB)
+#define glVertexAttrib4Niv MANGLE(VertexAttrib4Niv)
+#define glVertexAttrib4NsvARB MANGLE(VertexAttrib4NsvARB)
+#define glVertexAttrib4Nsv MANGLE(VertexAttrib4Nsv)
+#define glVertexAttrib4NubARB MANGLE(VertexAttrib4NubARB)
+#define glVertexAttrib4Nub MANGLE(VertexAttrib4Nub)
+#define glVertexAttrib4NubvARB MANGLE(VertexAttrib4NubvARB)
+#define glVertexAttrib4Nubv MANGLE(VertexAttrib4Nubv)
+#define glVertexAttrib4NuivARB MANGLE(VertexAttrib4NuivARB)
+#define glVertexAttrib4Nuiv MANGLE(VertexAttrib4Nuiv)
+#define glVertexAttrib4NusvARB MANGLE(VertexAttrib4NusvARB)
+#define glVertexAttrib4Nusv MANGLE(VertexAttrib4Nusv)
+#define glVertexAttrib4sARB MANGLE(VertexAttrib4sARB)
+#define glVertexAttrib4s MANGLE(VertexAttrib4s)
+#define glVertexAttrib4sNV MANGLE(VertexAttrib4sNV)
+#define glVertexAttrib4svARB MANGLE(VertexAttrib4svARB)
+#define glVertexAttrib4sv MANGLE(VertexAttrib4sv)
+#define glVertexAttrib4svNV MANGLE(VertexAttrib4svNV)
+#define glVertexAttrib4ubNV MANGLE(VertexAttrib4ubNV)
+#define glVertexAttrib4ubvARB MANGLE(VertexAttrib4ubvARB)
+#define glVertexAttrib4ubv MANGLE(VertexAttrib4ubv)
+#define glVertexAttrib4ubvNV MANGLE(VertexAttrib4ubvNV)
+#define glVertexAttrib4uivARB MANGLE(VertexAttrib4uivARB)
+#define glVertexAttrib4uiv MANGLE(VertexAttrib4uiv)
+#define glVertexAttrib4usvARB MANGLE(VertexAttrib4usvARB)
+#define glVertexAttrib4usv MANGLE(VertexAttrib4usv)
+#define glVertexAttribArrayObjectATI MANGLE(VertexAttribArrayObjectATI)
+#define glVertexAttribPointerARB MANGLE(VertexAttribPointerARB)
+#define glVertexAttribPointer MANGLE(VertexAttribPointer)
+#define glVertexAttribPointerNV MANGLE(VertexAttribPointerNV)
+#define glVertexAttribs1dvNV MANGLE(VertexAttribs1dvNV)
+#define glVertexAttribs1fvNV MANGLE(VertexAttribs1fvNV)
+#define glVertexAttribs1hvNV MANGLE(VertexAttribs1hvNV)
+#define glVertexAttribs1svNV MANGLE(VertexAttribs1svNV)
+#define glVertexAttribs2dvNV MANGLE(VertexAttribs2dvNV)
+#define glVertexAttribs2fvNV MANGLE(VertexAttribs2fvNV)
+#define glVertexAttribs2hvNV MANGLE(VertexAttribs2hvNV)
+#define glVertexAttribs2svNV MANGLE(VertexAttribs2svNV)
+#define glVertexAttribs3dvNV MANGLE(VertexAttribs3dvNV)
+#define glVertexAttribs3fvNV MANGLE(VertexAttribs3fvNV)
+#define glVertexAttribs3hvNV MANGLE(VertexAttribs3hvNV)
+#define glVertexAttribs3svNV MANGLE(VertexAttribs3svNV)
+#define glVertexAttribs4dvNV MANGLE(VertexAttribs4dvNV)
+#define glVertexAttribs4fvNV MANGLE(VertexAttribs4fvNV)
+#define glVertexAttribs4hvNV MANGLE(VertexAttribs4hvNV)
+#define glVertexAttribs4svNV MANGLE(VertexAttribs4svNV)
+#define glVertexAttribs4ubvNV MANGLE(VertexAttribs4ubvNV)
+#define glVertexBlendARB MANGLE(VertexBlendARB)
+#define glVertexBlendEnvfATI MANGLE(VertexBlendEnvfATI)
+#define glVertexBlendEnviATI MANGLE(VertexBlendEnviATI)
+#define glVertexPointerEXT MANGLE(VertexPointerEXT)
+#define glVertexPointerListIBM MANGLE(VertexPointerListIBM)
+#define glVertexPointer MANGLE(VertexPointer)
+#define glVertexPointervINTEL MANGLE(VertexPointervINTEL)
+#define glVertexStream1dATI MANGLE(VertexStream1dATI)
+#define glVertexStream1dvATI MANGLE(VertexStream1dvATI)
+#define glVertexStream1fATI MANGLE(VertexStream1fATI)
+#define glVertexStream1fvATI MANGLE(VertexStream1fvATI)
+#define glVertexStream1iATI MANGLE(VertexStream1iATI)
+#define glVertexStream1ivATI MANGLE(VertexStream1ivATI)
+#define glVertexStream1sATI MANGLE(VertexStream1sATI)
+#define glVertexStream1svATI MANGLE(VertexStream1svATI)
+#define glVertexStream2dATI MANGLE(VertexStream2dATI)
+#define glVertexStream2dvATI MANGLE(VertexStream2dvATI)
+#define glVertexStream2fATI MANGLE(VertexStream2fATI)
+#define glVertexStream2fvATI MANGLE(VertexStream2fvATI)
+#define glVertexStream2iATI MANGLE(VertexStream2iATI)
+#define glVertexStream2ivATI MANGLE(VertexStream2ivATI)
+#define glVertexStream2sATI MANGLE(VertexStream2sATI)
+#define glVertexStream2svATI MANGLE(VertexStream2svATI)
+#define glVertexStream3dATI MANGLE(VertexStream3dATI)
+#define glVertexStream3dvATI MANGLE(VertexStream3dvATI)
+#define glVertexStream3fATI MANGLE(VertexStream3fATI)
+#define glVertexStream3fvATI MANGLE(VertexStream3fvATI)
+#define glVertexStream3iATI MANGLE(VertexStream3iATI)
+#define glVertexStream3ivATI MANGLE(VertexStream3ivATI)
+#define glVertexStream3sATI MANGLE(VertexStream3sATI)
+#define glVertexStream3svATI MANGLE(VertexStream3svATI)
+#define glVertexStream4dATI MANGLE(VertexStream4dATI)
+#define glVertexStream4dvATI MANGLE(VertexStream4dvATI)
+#define glVertexStream4fATI MANGLE(VertexStream4fATI)
+#define glVertexStream4fvATI MANGLE(VertexStream4fvATI)
+#define glVertexStream4iATI MANGLE(VertexStream4iATI)
+#define glVertexStream4ivATI MANGLE(VertexStream4ivATI)
+#define glVertexStream4sATI MANGLE(VertexStream4sATI)
+#define glVertexStream4svATI MANGLE(VertexStream4svATI)
+#define glVertexWeightfEXT MANGLE(VertexWeightfEXT)
+#define glVertexWeightfvEXT MANGLE(VertexWeightfvEXT)
+#define glVertexWeighthNV MANGLE(VertexWeighthNV)
+#define glVertexWeighthvNV MANGLE(VertexWeighthvNV)
+#define glVertexWeightPointerEXT MANGLE(VertexWeightPointerEXT)
+#define glViewport MANGLE(Viewport)
+#define glWeightbvARB MANGLE(WeightbvARB)
+#define glWeightdvARB MANGLE(WeightdvARB)
+#define glWeightfvARB MANGLE(WeightfvARB)
+#define glWeightivARB MANGLE(WeightivARB)
+#define glWeightPointerARB MANGLE(WeightPointerARB)
+#define glWeightsvARB MANGLE(WeightsvARB)
+#define glWeightubvARB MANGLE(WeightubvARB)
+#define glWeightuivARB MANGLE(WeightuivARB)
+#define glWeightusvARB MANGLE(WeightusvARB)
+#define glWindowPos2dARB MANGLE(WindowPos2dARB)
+#define glWindowPos2d MANGLE(WindowPos2d)
+#define glWindowPos2dMESA MANGLE(WindowPos2dMESA)
+#define glWindowPos2dvARB MANGLE(WindowPos2dvARB)
+#define glWindowPos2dv MANGLE(WindowPos2dv)
+#define glWindowPos2dvMESA MANGLE(WindowPos2dvMESA)
+#define glWindowPos2fARB MANGLE(WindowPos2fARB)
+#define glWindowPos2f MANGLE(WindowPos2f)
+#define glWindowPos2fMESA MANGLE(WindowPos2fMESA)
+#define glWindowPos2fvARB MANGLE(WindowPos2fvARB)
+#define glWindowPos2fv MANGLE(WindowPos2fv)
+#define glWindowPos2fvMESA MANGLE(WindowPos2fvMESA)
+#define glWindowPos2iARB MANGLE(WindowPos2iARB)
+#define glWindowPos2i MANGLE(WindowPos2i)
+#define glWindowPos2iMESA MANGLE(WindowPos2iMESA)
+#define glWindowPos2ivARB MANGLE(WindowPos2ivARB)
+#define glWindowPos2iv MANGLE(WindowPos2iv)
+#define glWindowPos2ivMESA MANGLE(WindowPos2ivMESA)
+#define glWindowPos2sARB MANGLE(WindowPos2sARB)
+#define glWindowPos2s MANGLE(WindowPos2s)
+#define glWindowPos2sMESA MANGLE(WindowPos2sMESA)
+#define glWindowPos2svARB MANGLE(WindowPos2svARB)
+#define glWindowPos2sv MANGLE(WindowPos2sv)
+#define glWindowPos2svMESA MANGLE(WindowPos2svMESA)
+#define glWindowPos3dARB MANGLE(WindowPos3dARB)
+#define glWindowPos3d MANGLE(WindowPos3d)
+#define glWindowPos3dMESA MANGLE(WindowPos3dMESA)
+#define glWindowPos3dvARB MANGLE(WindowPos3dvARB)
+#define glWindowPos3dv MANGLE(WindowPos3dv)
+#define glWindowPos3dvMESA MANGLE(WindowPos3dvMESA)
+#define glWindowPos3fARB MANGLE(WindowPos3fARB)
+#define glWindowPos3f MANGLE(WindowPos3f)
+#define glWindowPos3fMESA MANGLE(WindowPos3fMESA)
+#define glWindowPos3fvARB MANGLE(WindowPos3fvARB)
+#define glWindowPos3fv MANGLE(WindowPos3fv)
+#define glWindowPos3fvMESA MANGLE(WindowPos3fvMESA)
+#define glWindowPos3iARB MANGLE(WindowPos3iARB)
+#define glWindowPos3i MANGLE(WindowPos3i)
+#define glWindowPos3iMESA MANGLE(WindowPos3iMESA)
+#define glWindowPos3ivARB MANGLE(WindowPos3ivARB)
+#define glWindowPos3iv MANGLE(WindowPos3iv)
+#define glWindowPos3ivMESA MANGLE(WindowPos3ivMESA)
+#define glWindowPos3sARB MANGLE(WindowPos3sARB)
+#define glWindowPos3s MANGLE(WindowPos3s)
+#define glWindowPos3sMESA MANGLE(WindowPos3sMESA)
+#define glWindowPos3svARB MANGLE(WindowPos3svARB)
+#define glWindowPos3sv MANGLE(WindowPos3sv)
+#define glWindowPos3svMESA MANGLE(WindowPos3svMESA)
+#define glWindowPos4dMESA MANGLE(WindowPos4dMESA)
+#define glWindowPos4dvMESA MANGLE(WindowPos4dvMESA)
+#define glWindowPos4fMESA MANGLE(WindowPos4fMESA)
+#define glWindowPos4fvMESA MANGLE(WindowPos4fvMESA)
+#define glWindowPos4iMESA MANGLE(WindowPos4iMESA)
+#define glWindowPos4ivMESA MANGLE(WindowPos4ivMESA)
+#define glWindowPos4sMESA MANGLE(WindowPos4sMESA)
+#define glWindowPos4svMESA MANGLE(WindowPos4svMESA)
+#define glWriteMaskEXT MANGLE(WriteMaskEXT)
+#endif /* GL_MANGLE_H */
diff --git a/include/GL/glext.h b/include/GL/glext.h
new file mode 100644
index 0000000..78fca0b
--- /dev/null
+++ b/include/GL/glext.h
@@ -0,0 +1,6495 @@
+#ifndef __glext_h_
+#define __glext_h_
+#ifdef __cplusplus
+extern "C" {
+** License Applicability. Except to the extent portions of this file are
+** made subject to an alternative license as permitted in the SGI Free
+** Software License B, Version 1.1 (the "License"), the contents of this
+** file are subject only to the provisions of the License. You may not use
+** this file except in compliance with the License. You may obtain a copy
+** of the License at Silicon Graphics, Inc., attn: Legal Services, 1600
+** Amphitheatre Parkway, Mountain View, CA 94043-1351, or at:
+** Note that, as provided in the License, the Software is distributed on an
+** Original Code. The Original Code is: OpenGL Sample Implementation,
+** Version 1.2.1, released January 26, 2000, developed by Silicon Graphics,
+** Inc. The Original Code is Copyright (c) 1991-2004 Silicon Graphics, Inc.
+** Copyright in any portions created by third parties is as indicated
+** elsewhere herein. All Rights Reserved.
+** Additional Notice Provisions: This software was created using the
+** OpenGL(R) version 1.2.1 Sample Implementation published by SGI, but has
+** not been independently verified as being compliant with the OpenGL(R)
+** version 1.2.1 Specification.
+#if defined(_WIN32) && !defined(APIENTRY) && !defined(__CYGWIN__) && !defined(__SCITECH_SNAP__)
+#define WIN32_LEAN_AND_MEAN 1
+#include <windows.h>
+#ifndef APIENTRY
+#define APIENTRY
+#ifndef APIENTRYP
+#ifndef GLAPI
+#define GLAPI extern
+/* Header file version number, required by OpenGL ABI for Linux */
+/* glext.h last updated 2005/06/20 */
+/* Current version at */
+#define GL_GLEXT_VERSION 29
+#ifndef GL_VERSION_1_2
+#define GL_UNSIGNED_BYTE_3_3_2 0x8032
+#define GL_UNSIGNED_SHORT_4_4_4_4 0x8033
+#define GL_UNSIGNED_SHORT_5_5_5_1 0x8034
+#define GL_UNSIGNED_INT_8_8_8_8 0x8035
+#define GL_UNSIGNED_INT_10_10_10_2 0x8036
+#define GL_RESCALE_NORMAL 0x803A
+#define GL_TEXTURE_BINDING_3D 0x806A
+#define GL_PACK_SKIP_IMAGES 0x806B
+#define GL_PACK_IMAGE_HEIGHT 0x806C
+#define GL_TEXTURE_3D 0x806F
+#define GL_PROXY_TEXTURE_3D 0x8070
+#define GL_TEXTURE_DEPTH 0x8071
+#define GL_TEXTURE_WRAP_R 0x8072
+#define GL_MAX_3D_TEXTURE_SIZE 0x8073
+#define GL_UNSIGNED_BYTE_2_3_3_REV 0x8362
+#define GL_UNSIGNED_SHORT_5_6_5 0x8363
+#define GL_UNSIGNED_SHORT_5_6_5_REV 0x8364
+#define GL_UNSIGNED_SHORT_4_4_4_4_REV 0x8365
+#define GL_UNSIGNED_SHORT_1_5_5_5_REV 0x8366
+#define GL_UNSIGNED_INT_8_8_8_8_REV 0x8367
+#define GL_UNSIGNED_INT_2_10_10_10_REV 0x8368
+#define GL_BGR 0x80E0
+#define GL_BGRA 0x80E1
+#define GL_CLAMP_TO_EDGE 0x812F
+#define GL_TEXTURE_MIN_LOD 0x813A
+#define GL_TEXTURE_MAX_LOD 0x813B
+#define GL_TEXTURE_MAX_LEVEL 0x813D
+#define GL_SINGLE_COLOR 0x81F9
+#ifndef GL_ARB_imaging
+#define GL_CONSTANT_COLOR 0x8001
+#define GL_CONSTANT_ALPHA 0x8003
+#define GL_BLEND_COLOR 0x8005
+#define GL_FUNC_ADD 0x8006
+#define GL_MIN 0x8007
+#define GL_MAX 0x8008
+#define GL_BLEND_EQUATION 0x8009
+#define GL_FUNC_SUBTRACT 0x800A
+#define GL_CONVOLUTION_1D 0x8010
+#define GL_CONVOLUTION_2D 0x8011
+#define GL_SEPARABLE_2D 0x8012
+#define GL_REDUCE 0x8016
+#define GL_CONVOLUTION_WIDTH 0x8018
+#define GL_HISTOGRAM 0x8024
+#define GL_PROXY_HISTOGRAM 0x8025
+#define GL_HISTOGRAM_WIDTH 0x8026
+#define GL_HISTOGRAM_FORMAT 0x8027
+#define GL_HISTOGRAM_RED_SIZE 0x8028
+#define GL_HISTOGRAM_SINK 0x802D
+#define GL_MINMAX 0x802E
+#define GL_MINMAX_FORMAT 0x802F
+#define GL_MINMAX_SINK 0x8030
+#define GL_TABLE_TOO_LARGE 0x8031
+#define GL_COLOR_MATRIX 0x80B1
+#define GL_COLOR_TABLE 0x80D0
+#define GL_PROXY_COLOR_TABLE 0x80D3
+#define GL_COLOR_TABLE_SCALE 0x80D6
+#define GL_COLOR_TABLE_BIAS 0x80D7
+#define GL_COLOR_TABLE_WIDTH 0x80D9
+#define GL_CONSTANT_BORDER 0x8151
+#define GL_REPLICATE_BORDER 0x8153
+#ifndef GL_VERSION_1_3
+#define GL_TEXTURE0 0x84C0
+#define GL_TEXTURE1 0x84C1
+#define GL_TEXTURE2 0x84C2
+#define GL_TEXTURE3 0x84C3
+#define GL_TEXTURE4 0x84C4
+#define GL_TEXTURE5 0x84C5
+#define GL_TEXTURE6 0x84C6
+#define GL_TEXTURE7 0x84C7
+#define GL_TEXTURE8 0x84C8
+#define GL_TEXTURE9 0x84C9
+#define GL_TEXTURE10 0x84CA
+#define GL_TEXTURE11 0x84CB
+#define GL_TEXTURE12 0x84CC
+#define GL_TEXTURE13 0x84CD
+#define GL_TEXTURE14 0x84CE
+#define GL_TEXTURE15 0x84CF
+#define GL_TEXTURE16 0x84D0
+#define GL_TEXTURE17 0x84D1
+#define GL_TEXTURE18 0x84D2
+#define GL_TEXTURE19 0x84D3
+#define GL_TEXTURE20 0x84D4
+#define GL_TEXTURE21 0x84D5
+#define GL_TEXTURE22 0x84D6
+#define GL_TEXTURE23 0x84D7
+#define GL_TEXTURE24 0x84D8
+#define GL_TEXTURE25 0x84D9
+#define GL_TEXTURE26 0x84DA
+#define GL_TEXTURE27 0x84DB
+#define GL_TEXTURE28 0x84DC
+#define GL_TEXTURE29 0x84DD
+#define GL_TEXTURE30 0x84DE
+#define GL_TEXTURE31 0x84DF
+#define GL_ACTIVE_TEXTURE 0x84E0
+#define GL_MAX_TEXTURE_UNITS 0x84E2
+#define GL_MULTISAMPLE 0x809D
+#define GL_SAMPLE_ALPHA_TO_ONE 0x809F
+#define GL_SAMPLE_COVERAGE 0x80A0
+#define GL_SAMPLE_BUFFERS 0x80A8
+#define GL_SAMPLES 0x80A9
+#define GL_MULTISAMPLE_BIT 0x20000000
+#define GL_NORMAL_MAP 0x8511
+#define GL_REFLECTION_MAP 0x8512
+#define GL_TEXTURE_CUBE_MAP 0x8513
+#define GL_CLAMP_TO_BORDER 0x812D
+#define GL_COMBINE 0x8570
+#define GL_COMBINE_RGB 0x8571
+#define GL_COMBINE_ALPHA 0x8572
+#define GL_SOURCE0_RGB 0x8580
+#define GL_SOURCE1_RGB 0x8581
+#define GL_SOURCE2_RGB 0x8582
+#define GL_SOURCE0_ALPHA 0x8588
+#define GL_SOURCE1_ALPHA 0x8589
+#define GL_SOURCE2_ALPHA 0x858A
+#define GL_OPERAND0_RGB 0x8590
+#define GL_OPERAND1_RGB 0x8591
+#define GL_OPERAND2_RGB 0x8592
+#define GL_OPERAND0_ALPHA 0x8598
+#define GL_OPERAND1_ALPHA 0x8599
+#define GL_OPERAND2_ALPHA 0x859A
+#define GL_RGB_SCALE 0x8573
+#define GL_ADD_SIGNED 0x8574
+#define GL_INTERPOLATE 0x8575
+#define GL_SUBTRACT 0x84E7
+#define GL_CONSTANT 0x8576
+#define GL_PRIMARY_COLOR 0x8577
+#define GL_PREVIOUS 0x8578
+#define GL_DOT3_RGB 0x86AE
+#define GL_DOT3_RGBA 0x86AF
+#ifndef GL_VERSION_1_4
+#define GL_BLEND_DST_RGB 0x80C8
+#define GL_BLEND_SRC_RGB 0x80C9
+#define GL_BLEND_DST_ALPHA 0x80CA
+#define GL_BLEND_SRC_ALPHA 0x80CB
+#define GL_POINT_SIZE_MIN 0x8126
+#define GL_POINT_SIZE_MAX 0x8127
+#define GL_GENERATE_MIPMAP 0x8191
+#define GL_DEPTH_COMPONENT16 0x81A5
+#define GL_DEPTH_COMPONENT24 0x81A6
+#define GL_DEPTH_COMPONENT32 0x81A7
+#define GL_MIRRORED_REPEAT 0x8370
+#define GL_FOG_COORDINATE 0x8451
+#define GL_FRAGMENT_DEPTH 0x8452
+#define GL_COLOR_SUM 0x8458
+#define GL_TEXTURE_LOD_BIAS 0x8501
+#define GL_INCR_WRAP 0x8507
+#define GL_DECR_WRAP 0x8508
+#ifndef GL_VERSION_1_5
+#define GL_BUFFER_SIZE 0x8764
+#define GL_BUFFER_USAGE 0x8765
+#define GL_QUERY_COUNTER_BITS 0x8864
+#define GL_CURRENT_QUERY 0x8865
+#define GL_QUERY_RESULT 0x8866
+#define GL_ARRAY_BUFFER 0x8892
+#define GL_READ_ONLY 0x88B8
+#define GL_WRITE_ONLY 0x88B9
+#define GL_READ_WRITE 0x88BA
+#define GL_BUFFER_ACCESS 0x88BB
+#define GL_BUFFER_MAPPED 0x88BC
+#define GL_STREAM_DRAW 0x88E0
+#define GL_STREAM_READ 0x88E1
+#define GL_STREAM_COPY 0x88E2
+#define GL_STATIC_DRAW 0x88E4
+#define GL_STATIC_READ 0x88E5
+#define GL_STATIC_COPY 0x88E6
+#define GL_DYNAMIC_DRAW 0x88E8
+#define GL_DYNAMIC_READ 0x88E9
+#define GL_DYNAMIC_COPY 0x88EA
+#define GL_SAMPLES_PASSED 0x8914
+#ifndef GL_VERSION_2_0
+#define GL_STENCIL_BACK_FUNC 0x8800
+#define GL_STENCIL_BACK_FAIL 0x8801
+#define GL_MAX_DRAW_BUFFERS 0x8824
+#define GL_DRAW_BUFFER0 0x8825
+#define GL_DRAW_BUFFER1 0x8826
+#define GL_DRAW_BUFFER2 0x8827
+#define GL_DRAW_BUFFER3 0x8828
+#define GL_DRAW_BUFFER4 0x8829
+#define GL_DRAW_BUFFER5 0x882A
+#define GL_DRAW_BUFFER6 0x882B
+#define GL_DRAW_BUFFER7 0x882C
+#define GL_DRAW_BUFFER8 0x882D
+#define GL_DRAW_BUFFER9 0x882E
+#define GL_DRAW_BUFFER10 0x882F
+#define GL_DRAW_BUFFER11 0x8830
+#define GL_DRAW_BUFFER12 0x8831
+#define GL_DRAW_BUFFER13 0x8832
+#define GL_DRAW_BUFFER14 0x8833
+#define GL_DRAW_BUFFER15 0x8834
+#define GL_POINT_SPRITE 0x8861
+#define GL_COORD_REPLACE 0x8862
+#define GL_MAX_VERTEX_ATTRIBS 0x8869
+#define GL_MAX_TEXTURE_COORDS 0x8871
+#define GL_FRAGMENT_SHADER 0x8B30
+#define GL_VERTEX_SHADER 0x8B31
+#define GL_SHADER_TYPE 0x8B4F
+#define GL_FLOAT_VEC2 0x8B50
+#define GL_FLOAT_VEC3 0x8B51
+#define GL_FLOAT_VEC4 0x8B52
+#define GL_INT_VEC2 0x8B53
+#define GL_INT_VEC3 0x8B54
+#define GL_INT_VEC4 0x8B55
+#define GL_BOOL 0x8B56
+#define GL_BOOL_VEC2 0x8B57
+#define GL_BOOL_VEC3 0x8B58
+#define GL_BOOL_VEC4 0x8B59
+#define GL_FLOAT_MAT2 0x8B5A
+#define GL_FLOAT_MAT3 0x8B5B
+#define GL_FLOAT_MAT4 0x8B5C
+#define GL_SAMPLER_1D 0x8B5D
+#define GL_SAMPLER_2D 0x8B5E
+#define GL_SAMPLER_3D 0x8B5F
+#define GL_SAMPLER_CUBE 0x8B60
+#define GL_SAMPLER_1D_SHADOW 0x8B61
+#define GL_SAMPLER_2D_SHADOW 0x8B62
+#define GL_DELETE_STATUS 0x8B80
+#define GL_COMPILE_STATUS 0x8B81
+#define GL_LINK_STATUS 0x8B82
+#define GL_VALIDATE_STATUS 0x8B83
+#define GL_INFO_LOG_LENGTH 0x8B84
+#define GL_ACTIVE_UNIFORMS 0x8B86
+#define GL_LOWER_LEFT 0x8CA1
+#define GL_UPPER_LEFT 0x8CA2
+#ifndef GL_ARB_multitexture
+#define GL_TEXTURE0_ARB 0x84C0
+#define GL_TEXTURE1_ARB 0x84C1
+#define GL_TEXTURE2_ARB 0x84C2
+#define GL_TEXTURE3_ARB 0x84C3
+#define GL_TEXTURE4_ARB 0x84C4
+#define GL_TEXTURE5_ARB 0x84C5
+#define GL_TEXTURE6_ARB 0x84C6
+#define GL_TEXTURE7_ARB 0x84C7
+#define GL_TEXTURE8_ARB 0x84C8
+#define GL_TEXTURE9_ARB 0x84C9
+#define GL_TEXTURE10_ARB 0x84CA
+#define GL_TEXTURE11_ARB 0x84CB
+#define GL_TEXTURE12_ARB 0x84CC
+#define GL_TEXTURE13_ARB 0x84CD
+#define GL_TEXTURE14_ARB 0x84CE
+#define GL_TEXTURE15_ARB 0x84CF
+#define GL_TEXTURE16_ARB 0x84D0
+#define GL_TEXTURE17_ARB 0x84D1
+#define GL_TEXTURE18_ARB 0x84D2
+#define GL_TEXTURE19_ARB 0x84D3
+#define GL_TEXTURE20_ARB 0x84D4
+#define GL_TEXTURE21_ARB 0x84D5
+#define GL_TEXTURE22_ARB 0x84D6
+#define GL_TEXTURE23_ARB 0x84D7
+#define GL_TEXTURE24_ARB 0x84D8
+#define GL_TEXTURE25_ARB 0x84D9
+#define GL_TEXTURE26_ARB 0x84DA
+#define GL_TEXTURE27_ARB 0x84DB
+#define GL_TEXTURE28_ARB 0x84DC
+#define GL_TEXTURE29_ARB 0x84DD
+#define GL_TEXTURE30_ARB 0x84DE
+#define GL_TEXTURE31_ARB 0x84DF
+#ifndef GL_ARB_transpose_matrix
+#ifndef GL_ARB_multisample
+#define GL_MULTISAMPLE_ARB 0x809D
+#define GL_SAMPLES_ARB 0x80A9
+#define GL_MULTISAMPLE_BIT_ARB 0x20000000
+#ifndef GL_ARB_texture_env_add
+#ifndef GL_ARB_texture_cube_map
+#define GL_NORMAL_MAP_ARB 0x8511
+#define GL_REFLECTION_MAP_ARB 0x8512
+#define GL_TEXTURE_CUBE_MAP_ARB 0x8513
+#ifndef GL_ARB_texture_compression
+#ifndef GL_ARB_texture_border_clamp
+#define GL_CLAMP_TO_BORDER_ARB 0x812D
+#ifndef GL_ARB_point_parameters
+#define GL_POINT_SIZE_MIN_ARB 0x8126
+#define GL_POINT_SIZE_MAX_ARB 0x8127
+#ifndef GL_ARB_vertex_blend
+#define GL_VERTEX_BLEND_ARB 0x86A7
+#define GL_MODELVIEW0_ARB 0x1700
+#define GL_MODELVIEW1_ARB 0x850A
+#define GL_MODELVIEW2_ARB 0x8722
+#define GL_MODELVIEW3_ARB 0x8723
+#define GL_MODELVIEW4_ARB 0x8724
+#define GL_MODELVIEW5_ARB 0x8725
+#define GL_MODELVIEW6_ARB 0x8726
+#define GL_MODELVIEW7_ARB 0x8727
+#define GL_MODELVIEW8_ARB 0x8728
+#define GL_MODELVIEW9_ARB 0x8729
+#define GL_MODELVIEW10_ARB 0x872A
+#define GL_MODELVIEW11_ARB 0x872B
+#define GL_MODELVIEW12_ARB 0x872C
+#define GL_MODELVIEW13_ARB 0x872D
+#define GL_MODELVIEW14_ARB 0x872E
+#define GL_MODELVIEW15_ARB 0x872F
+#define GL_MODELVIEW16_ARB 0x8730
+#define GL_MODELVIEW17_ARB 0x8731
+#define GL_MODELVIEW18_ARB 0x8732
+#define GL_MODELVIEW19_ARB 0x8733
+#define GL_MODELVIEW20_ARB 0x8734
+#define GL_MODELVIEW21_ARB 0x8735
+#define GL_MODELVIEW22_ARB 0x8736
+#define GL_MODELVIEW23_ARB 0x8737
+#define GL_MODELVIEW24_ARB 0x8738
+#define GL_MODELVIEW25_ARB 0x8739
+#define GL_MODELVIEW26_ARB 0x873A
+#define GL_MODELVIEW27_ARB 0x873B
+#define GL_MODELVIEW28_ARB 0x873C
+#define GL_MODELVIEW29_ARB 0x873D
+#define GL_MODELVIEW30_ARB 0x873E
+#define GL_MODELVIEW31_ARB 0x873F
+#ifndef GL_ARB_matrix_palette
+#define GL_MATRIX_PALETTE_ARB 0x8840
+#ifndef GL_ARB_texture_env_combine
+#define GL_COMBINE_ARB 0x8570
+#define GL_COMBINE_RGB_ARB 0x8571
+#define GL_COMBINE_ALPHA_ARB 0x8572
+#define GL_SOURCE0_RGB_ARB 0x8580
+#define GL_SOURCE1_RGB_ARB 0x8581
+#define GL_SOURCE2_RGB_ARB 0x8582
+#define GL_SOURCE0_ALPHA_ARB 0x8588
+#define GL_SOURCE1_ALPHA_ARB 0x8589
+#define GL_SOURCE2_ALPHA_ARB 0x858A
+#define GL_OPERAND0_RGB_ARB 0x8590
+#define GL_OPERAND1_RGB_ARB 0x8591
+#define GL_OPERAND2_RGB_ARB 0x8592
+#define GL_OPERAND0_ALPHA_ARB 0x8598
+#define GL_OPERAND1_ALPHA_ARB 0x8599
+#define GL_OPERAND2_ALPHA_ARB 0x859A
+#define GL_RGB_SCALE_ARB 0x8573
+#define GL_ADD_SIGNED_ARB 0x8574
+#define GL_INTERPOLATE_ARB 0x8575
+#define GL_SUBTRACT_ARB 0x84E7
+#define GL_CONSTANT_ARB 0x8576
+#define GL_PRIMARY_COLOR_ARB 0x8577
+#define GL_PREVIOUS_ARB 0x8578
+#ifndef GL_ARB_texture_env_crossbar
+#ifndef GL_ARB_texture_env_dot3
+#define GL_DOT3_RGB_ARB 0x86AE
+#define GL_DOT3_RGBA_ARB 0x86AF
+#ifndef GL_ARB_texture_mirrored_repeat
+#define GL_MIRRORED_REPEAT_ARB 0x8370
+#ifndef GL_ARB_depth_texture
+#define GL_DEPTH_COMPONENT16_ARB 0x81A5
+#define GL_DEPTH_COMPONENT24_ARB 0x81A6
+#define GL_DEPTH_COMPONENT32_ARB 0x81A7
+#ifndef GL_ARB_shadow
+#ifndef GL_ARB_shadow_ambient
+#ifndef GL_ARB_window_pos
+#ifndef GL_ARB_vertex_program
+#define GL_COLOR_SUM_ARB 0x8458
+#define GL_VERTEX_PROGRAM_ARB 0x8620
+#define GL_PROGRAM_LENGTH_ARB 0x8627
+#define GL_PROGRAM_STRING_ARB 0x8628
+#define GL_CURRENT_MATRIX_ARB 0x8641
+#define GL_PROGRAM_BINDING_ARB 0x8677
+#define GL_PROGRAM_FORMAT_ARB 0x8876
+#define GL_MATRIX0_ARB 0x88C0
+#define GL_MATRIX1_ARB 0x88C1
+#define GL_MATRIX2_ARB 0x88C2
+#define GL_MATRIX3_ARB 0x88C3
+#define GL_MATRIX4_ARB 0x88C4
+#define GL_MATRIX5_ARB 0x88C5
+#define GL_MATRIX6_ARB 0x88C6
+#define GL_MATRIX7_ARB 0x88C7
+#define GL_MATRIX8_ARB 0x88C8
+#define GL_MATRIX9_ARB 0x88C9
+#define GL_MATRIX10_ARB 0x88CA
+#define GL_MATRIX11_ARB 0x88CB
+#define GL_MATRIX12_ARB 0x88CC
+#define GL_MATRIX13_ARB 0x88CD
+#define GL_MATRIX14_ARB 0x88CE
+#define GL_MATRIX15_ARB 0x88CF
+#define GL_MATRIX16_ARB 0x88D0
+#define GL_MATRIX17_ARB 0x88D1
+#define GL_MATRIX18_ARB 0x88D2
+#define GL_MATRIX19_ARB 0x88D3
+#define GL_MATRIX20_ARB 0x88D4
+#define GL_MATRIX21_ARB 0x88D5
+#define GL_MATRIX22_ARB 0x88D6
+#define GL_MATRIX23_ARB 0x88D7
+#define GL_MATRIX24_ARB 0x88D8
+#define GL_MATRIX25_ARB 0x88D9
+#define GL_MATRIX26_ARB 0x88DA
+#define GL_MATRIX27_ARB 0x88DB
+#define GL_MATRIX28_ARB 0x88DC
+#define GL_MATRIX29_ARB 0x88DD
+#define GL_MATRIX30_ARB 0x88DE
+#define GL_MATRIX31_ARB 0x88DF
+#ifndef GL_ARB_fragment_program
+#ifndef GL_ARB_vertex_buffer_object
+#define GL_BUFFER_SIZE_ARB 0x8764
+#define GL_BUFFER_USAGE_ARB 0x8765
+#define GL_ARRAY_BUFFER_ARB 0x8892
+#define GL_READ_ONLY_ARB 0x88B8
+#define GL_WRITE_ONLY_ARB 0x88B9
+#define GL_READ_WRITE_ARB 0x88BA
+#define GL_STREAM_DRAW_ARB 0x88E0
+#define GL_STREAM_READ_ARB 0x88E1
+#define GL_STREAM_COPY_ARB 0x88E2
+#define GL_STATIC_DRAW_ARB 0x88E4
+#define GL_STATIC_READ_ARB 0x88E5
+#define GL_STATIC_COPY_ARB 0x88E6
+#define GL_DYNAMIC_DRAW_ARB 0x88E8
+#define GL_DYNAMIC_READ_ARB 0x88E9
+#ifndef GL_ARB_occlusion_query
+#define GL_CURRENT_QUERY_ARB 0x8865
+#define GL_QUERY_RESULT_ARB 0x8866
+#define GL_SAMPLES_PASSED_ARB 0x8914
+#ifndef GL_ARB_shader_objects
+#define GL_SHADER_OBJECT_ARB 0x8B48
+#define GL_OBJECT_TYPE_ARB 0x8B4E
+#define GL_FLOAT_VEC2_ARB 0x8B50
+#define GL_FLOAT_VEC3_ARB 0x8B51
+#define GL_FLOAT_VEC4_ARB 0x8B52
+#define GL_INT_VEC2_ARB 0x8B53
+#define GL_INT_VEC3_ARB 0x8B54
+#define GL_INT_VEC4_ARB 0x8B55
+#define GL_BOOL_ARB 0x8B56
+#define GL_BOOL_VEC2_ARB 0x8B57
+#define GL_BOOL_VEC3_ARB 0x8B58
+#define GL_BOOL_VEC4_ARB 0x8B59
+#define GL_FLOAT_MAT2_ARB 0x8B5A
+#define GL_FLOAT_MAT3_ARB 0x8B5B
+#define GL_FLOAT_MAT4_ARB 0x8B5C
+#define GL_SAMPLER_1D_ARB 0x8B5D
+#define GL_SAMPLER_2D_ARB 0x8B5E
+#define GL_SAMPLER_3D_ARB 0x8B5F
+#define GL_SAMPLER_CUBE_ARB 0x8B60
+#define GL_SAMPLER_1D_SHADOW_ARB 0x8B61
+#define GL_SAMPLER_2D_SHADOW_ARB 0x8B62
+#define GL_SAMPLER_2D_RECT_ARB 0x8B63
+#ifndef GL_ARB_vertex_shader
+#define GL_VERTEX_SHADER_ARB 0x8B31
+#ifndef GL_ARB_fragment_shader
+#ifndef GL_ARB_shading_language_100
+#ifndef GL_ARB_texture_non_power_of_two
+#ifndef GL_ARB_point_sprite
+#define GL_POINT_SPRITE_ARB 0x8861
+#define GL_COORD_REPLACE_ARB 0x8862
+#ifndef GL_ARB_fragment_program_shadow
+#ifndef GL_ARB_draw_buffers
+#define GL_MAX_DRAW_BUFFERS_ARB 0x8824
+#define GL_DRAW_BUFFER0_ARB 0x8825
+#define GL_DRAW_BUFFER1_ARB 0x8826
+#define GL_DRAW_BUFFER2_ARB 0x8827
+#define GL_DRAW_BUFFER3_ARB 0x8828
+#define GL_DRAW_BUFFER4_ARB 0x8829
+#define GL_DRAW_BUFFER5_ARB 0x882A
+#define GL_DRAW_BUFFER6_ARB 0x882B
+#define GL_DRAW_BUFFER7_ARB 0x882C
+#define GL_DRAW_BUFFER8_ARB 0x882D
+#define GL_DRAW_BUFFER9_ARB 0x882E
+#define GL_DRAW_BUFFER10_ARB 0x882F
+#define GL_DRAW_BUFFER11_ARB 0x8830
+#define GL_DRAW_BUFFER12_ARB 0x8831
+#define GL_DRAW_BUFFER13_ARB 0x8832
+#define GL_DRAW_BUFFER14_ARB 0x8833
+#define GL_DRAW_BUFFER15_ARB 0x8834
+#ifndef GL_ARB_texture_rectangle
+#ifndef GL_ARB_color_buffer_float
+#define GL_RGBA_FLOAT_MODE_ARB 0x8820
+#define GL_FIXED_ONLY_ARB 0x891D
+#ifndef GL_ARB_half_float_pixel
+#define GL_HALF_FLOAT_ARB 0x140B
+#ifndef GL_ARB_texture_float
+#define GL_RGBA32F_ARB 0x8814
+#define GL_RGB32F_ARB 0x8815
+#define GL_ALPHA32F_ARB 0x8816
+#define GL_INTENSITY32F_ARB 0x8817
+#define GL_LUMINANCE32F_ARB 0x8818
+#define GL_LUMINANCE_ALPHA32F_ARB 0x8819
+#define GL_RGBA16F_ARB 0x881A
+#define GL_RGB16F_ARB 0x881B
+#define GL_ALPHA16F_ARB 0x881C
+#define GL_INTENSITY16F_ARB 0x881D
+#define GL_LUMINANCE16F_ARB 0x881E
+#ifndef GL_ARB_pixel_buffer_object
+#ifndef GL_EXT_abgr
+#define GL_ABGR_EXT 0x8000
+#ifndef GL_EXT_blend_color
+#define GL_CONSTANT_COLOR_EXT 0x8001
+#define GL_CONSTANT_ALPHA_EXT 0x8003
+#define GL_BLEND_COLOR_EXT 0x8005
+#ifndef GL_EXT_polygon_offset
+#define GL_POLYGON_OFFSET_EXT 0x8037
+#ifndef GL_EXT_texture
+#define GL_ALPHA4_EXT 0x803B
+#define GL_ALPHA8_EXT 0x803C
+#define GL_ALPHA12_EXT 0x803D
+#define GL_ALPHA16_EXT 0x803E
+#define GL_LUMINANCE4_EXT 0x803F
+#define GL_LUMINANCE8_EXT 0x8040
+#define GL_LUMINANCE12_EXT 0x8041
+#define GL_LUMINANCE16_EXT 0x8042
+#define GL_LUMINANCE4_ALPHA4_EXT 0x8043
+#define GL_LUMINANCE6_ALPHA2_EXT 0x8044
+#define GL_LUMINANCE8_ALPHA8_EXT 0x8045
+#define GL_LUMINANCE12_ALPHA4_EXT 0x8046
+#define GL_LUMINANCE12_ALPHA12_EXT 0x8047
+#define GL_LUMINANCE16_ALPHA16_EXT 0x8048
+#define GL_INTENSITY_EXT 0x8049
+#define GL_INTENSITY4_EXT 0x804A
+#define GL_INTENSITY8_EXT 0x804B
+#define GL_INTENSITY12_EXT 0x804C
+#define GL_INTENSITY16_EXT 0x804D
+#define GL_RGB2_EXT 0x804E
+#define GL_RGB4_EXT 0x804F
+#define GL_RGB5_EXT 0x8050
+#define GL_RGB8_EXT 0x8051
+#define GL_RGB10_EXT 0x8052
+#define GL_RGB12_EXT 0x8053
+#define GL_RGB16_EXT 0x8054
+#define GL_RGBA2_EXT 0x8055
+#define GL_RGBA4_EXT 0x8056
+#define GL_RGB5_A1_EXT 0x8057
+#define GL_RGBA8_EXT 0x8058
+#define GL_RGB10_A2_EXT 0x8059
+#define GL_RGBA12_EXT 0x805A
+#define GL_RGBA16_EXT 0x805B
+#define GL_REPLACE_EXT 0x8062
+#define GL_PROXY_TEXTURE_1D_EXT 0x8063
+#define GL_PROXY_TEXTURE_2D_EXT 0x8064
+#define GL_TEXTURE_TOO_LARGE_EXT 0x8065
+#ifndef GL_EXT_texture3D
+#define GL_TEXTURE_3D_EXT 0x806F
+#define GL_PROXY_TEXTURE_3D_EXT 0x8070
+#define GL_TEXTURE_DEPTH_EXT 0x8071
+#define GL_TEXTURE_WRAP_R_EXT 0x8072
+#define GL_MAX_3D_TEXTURE_SIZE_EXT 0x8073
+#ifndef GL_SGIS_texture_filter4
+#define GL_FILTER4_SGIS 0x8146
+#ifndef GL_EXT_subtexture
+#ifndef GL_EXT_copy_texture
+#ifndef GL_EXT_histogram
+#define GL_HISTOGRAM_EXT 0x8024
+#define GL_PROXY_HISTOGRAM_EXT 0x8025
+#define GL_HISTOGRAM_WIDTH_EXT 0x8026
+#define GL_MINMAX_EXT 0x802E
+#define GL_MINMAX_FORMAT_EXT 0x802F
+#define GL_MINMAX_SINK_EXT 0x8030
+#define GL_TABLE_TOO_LARGE_EXT 0x8031
+#ifndef GL_EXT_convolution
+#define GL_CONVOLUTION_1D_EXT 0x8010
+#define GL_CONVOLUTION_2D_EXT 0x8011
+#define GL_SEPARABLE_2D_EXT 0x8012
+#define GL_REDUCE_EXT 0x8016
+#ifndef GL_SGI_color_matrix
+#define GL_COLOR_MATRIX_SGI 0x80B1
+#ifndef GL_SGI_color_table
+#define GL_COLOR_TABLE_SGI 0x80D0
+#ifndef GL_SGIS_pixel_texture
+#define GL_PIXEL_TEXTURE_SGIS 0x8353
+#ifndef GL_SGIX_pixel_texture
+#define GL_PIXEL_TEX_GEN_SGIX 0x8139
+#ifndef GL_SGIS_texture4D
+#define GL_PACK_IMAGE_DEPTH_SGIS 0x8131
+#define GL_TEXTURE_4D_SGIS 0x8134
+#define GL_PROXY_TEXTURE_4D_SGIS 0x8135
+#define GL_TEXTURE_4DSIZE_SGIS 0x8136
+#define GL_TEXTURE_WRAP_Q_SGIS 0x8137
+#define GL_MAX_4D_TEXTURE_SIZE_SGIS 0x8138
+#ifndef GL_SGI_texture_color_table
+#ifndef GL_EXT_cmyka
+#define GL_CMYK_EXT 0x800C
+#define GL_CMYKA_EXT 0x800D
+#define GL_PACK_CMYK_HINT_EXT 0x800E
+#ifndef GL_EXT_texture_object
+#define GL_TEXTURE_1D_BINDING_EXT 0x8068
+#define GL_TEXTURE_2D_BINDING_EXT 0x8069
+#ifndef GL_SGIS_detail_texture
+#define GL_DETAIL_TEXTURE_2D_SGIS 0x8095
+#define GL_LINEAR_DETAIL_SGIS 0x8097
+#ifndef GL_SGIS_sharpen_texture
+#ifndef GL_EXT_packed_pixels
+#define GL_UNSIGNED_BYTE_3_3_2_EXT 0x8032
+#define GL_UNSIGNED_SHORT_4_4_4_4_EXT 0x8033
+#define GL_UNSIGNED_SHORT_5_5_5_1_EXT 0x8034
+#define GL_UNSIGNED_INT_8_8_8_8_EXT 0x8035
+#define GL_UNSIGNED_INT_10_10_10_2_EXT 0x8036
+#ifndef GL_SGIS_texture_lod
+#ifndef GL_SGIS_multisample
+#define GL_SAMPLE_MASK_SGIS 0x80A0
+#define GL_1PASS_SGIS 0x80A1
+#define GL_2PASS_0_SGIS 0x80A2
+#define GL_2PASS_1_SGIS 0x80A3
+#define GL_4PASS_0_SGIS 0x80A4
+#define GL_4PASS_1_SGIS 0x80A5
+#define GL_4PASS_2_SGIS 0x80A6
+#define GL_4PASS_3_SGIS 0x80A7
+#define GL_SAMPLES_SGIS 0x80A9
+#ifndef GL_EXT_rescale_normal
+#ifndef GL_EXT_vertex_array
+#define GL_VERTEX_ARRAY_EXT 0x8074
+#define GL_NORMAL_ARRAY_EXT 0x8075
+#define GL_COLOR_ARRAY_EXT 0x8076
+#define GL_INDEX_ARRAY_EXT 0x8077
+#define GL_EDGE_FLAG_ARRAY_EXT 0x8079
+#define GL_COLOR_ARRAY_SIZE_EXT 0x8081
+#define GL_COLOR_ARRAY_TYPE_EXT 0x8082
+#define GL_COLOR_ARRAY_COUNT_EXT 0x8084
+#define GL_INDEX_ARRAY_TYPE_EXT 0x8085
+#define GL_INDEX_ARRAY_COUNT_EXT 0x8087
+#ifndef GL_EXT_misc_attribute
+#ifndef GL_SGIS_generate_mipmap
+#ifndef GL_SGIX_clipmap
+#ifndef GL_SGIX_shadow
+#ifndef GL_SGIS_texture_edge_clamp
+#define GL_CLAMP_TO_EDGE_SGIS 0x812F
+#ifndef GL_SGIS_texture_border_clamp
+#ifndef GL_EXT_blend_minmax
+#define GL_FUNC_ADD_EXT 0x8006
+#define GL_MIN_EXT 0x8007
+#define GL_MAX_EXT 0x8008
+#define GL_BLEND_EQUATION_EXT 0x8009
+#ifndef GL_EXT_blend_subtract
+#define GL_FUNC_SUBTRACT_EXT 0x800A
+#ifndef GL_EXT_blend_logic_op
+#ifndef GL_SGIX_interlace
+#define GL_INTERLACE_SGIX 0x8094
+#ifndef GL_SGIX_pixel_tiles
+#define GL_PIXEL_TILE_WIDTH_SGIX 0x8140
+#ifndef GL_SGIS_texture_select
+#define GL_DUAL_ALPHA4_SGIS 0x8110
+#define GL_DUAL_ALPHA8_SGIS 0x8111
+#define GL_DUAL_ALPHA12_SGIS 0x8112
+#define GL_DUAL_ALPHA16_SGIS 0x8113
+#define GL_DUAL_LUMINANCE4_SGIS 0x8114
+#define GL_DUAL_LUMINANCE8_SGIS 0x8115
+#define GL_DUAL_LUMINANCE12_SGIS 0x8116
+#define GL_DUAL_LUMINANCE16_SGIS 0x8117
+#define GL_DUAL_INTENSITY4_SGIS 0x8118
+#define GL_DUAL_INTENSITY8_SGIS 0x8119
+#define GL_DUAL_INTENSITY12_SGIS 0x811A
+#define GL_DUAL_INTENSITY16_SGIS 0x811B
+#define GL_QUAD_ALPHA4_SGIS 0x811E
+#define GL_QUAD_ALPHA8_SGIS 0x811F
+#define GL_QUAD_LUMINANCE4_SGIS 0x8120
+#define GL_QUAD_LUMINANCE8_SGIS 0x8121
+#define GL_QUAD_INTENSITY4_SGIS 0x8122
+#define GL_QUAD_INTENSITY8_SGIS 0x8123
+#ifndef GL_SGIX_sprite
+#define GL_SPRITE_SGIX 0x8148
+#define GL_SPRITE_MODE_SGIX 0x8149
+#define GL_SPRITE_AXIS_SGIX 0x814A
+#define GL_SPRITE_AXIAL_SGIX 0x814C
+#ifndef GL_SGIX_texture_multi_buffer
+#ifndef GL_EXT_point_parameters
+#define GL_POINT_SIZE_MIN_EXT 0x8126
+#define GL_POINT_SIZE_MAX_EXT 0x8127
+#ifndef GL_SGIS_point_parameters
+#define GL_POINT_SIZE_MIN_SGIS 0x8126
+#define GL_POINT_SIZE_MAX_SGIS 0x8127
+#ifndef GL_SGIX_instruments
+#ifndef GL_SGIX_texture_scale_bias
+#ifndef GL_SGIX_framezoom
+#define GL_FRAMEZOOM_SGIX 0x818B
+#ifndef GL_SGIX_tag_sample_buffer
+#ifndef GL_FfdMaskSGIX
+#ifndef GL_SGIX_polynomial_ffd
+#ifndef GL_SGIX_reference_plane
+#ifndef GL_SGIX_flush_raster
+#ifndef GL_SGIX_depth_texture
+#ifndef GL_SGIS_fog_function
+#define GL_FOG_FUNC_SGIS 0x812A
+#ifndef GL_SGIX_fog_offset
+#define GL_FOG_OFFSET_SGIX 0x8198
+#define GL_FOG_OFFSET_VALUE_SGIX 0x8199
+#ifndef GL_HP_image_transform
+#define GL_IMAGE_SCALE_X_HP 0x8155
+#define GL_IMAGE_SCALE_Y_HP 0x8156
+#define GL_IMAGE_TRANSLATE_X_HP 0x8157
+#define GL_IMAGE_TRANSLATE_Y_HP 0x8158
+#define GL_IMAGE_ROTATE_ANGLE_HP 0x8159
+#define GL_IMAGE_MAG_FILTER_HP 0x815C
+#define GL_IMAGE_MIN_FILTER_HP 0x815D
+#define GL_CUBIC_HP 0x815F
+#define GL_AVERAGE_HP 0x8160
+#define GL_IMAGE_TRANSFORM_2D_HP 0x8161
+#ifndef GL_HP_convolution_border_modes
+#define GL_IGNORE_BORDER_HP 0x8150
+#define GL_CONSTANT_BORDER_HP 0x8151
+#define GL_REPLICATE_BORDER_HP 0x8153
+#ifndef GL_INGR_palette_buffer
+#ifndef GL_SGIX_texture_add_env
+#ifndef GL_EXT_color_subtable
+#ifndef GL_PGI_vertex_hints
+#define GL_COLOR3_BIT_PGI 0x00010000
+#define GL_COLOR4_BIT_PGI 0x00020000
+#define GL_EDGEFLAG_BIT_PGI 0x00040000
+#define GL_INDEX_BIT_PGI 0x00080000
+#define GL_MAT_AMBIENT_BIT_PGI 0x00100000
+#define GL_MAT_DIFFUSE_BIT_PGI 0x00400000
+#define GL_MAT_EMISSION_BIT_PGI 0x00800000
+#define GL_MAT_COLOR_INDEXES_BIT_PGI 0x01000000
+#define GL_MAT_SHININESS_BIT_PGI 0x02000000
+#define GL_MAT_SPECULAR_BIT_PGI 0x04000000
+#define GL_NORMAL_BIT_PGI 0x08000000
+#define GL_TEXCOORD1_BIT_PGI 0x10000000
+#define GL_TEXCOORD2_BIT_PGI 0x20000000
+#define GL_TEXCOORD3_BIT_PGI 0x40000000
+#define GL_TEXCOORD4_BIT_PGI 0x80000000
+#define GL_VERTEX23_BIT_PGI 0x00000004
+#define GL_VERTEX4_BIT_PGI 0x00000008
+#ifndef GL_PGI_misc_hints
+#define GL_CLIP_NEAR_HINT_PGI 0x1A220
+#define GL_CLIP_FAR_HINT_PGI 0x1A221
+#define GL_WIDE_LINE_HINT_PGI 0x1A222
+#ifndef GL_EXT_paletted_texture
+#define GL_COLOR_INDEX1_EXT 0x80E2
+#define GL_COLOR_INDEX2_EXT 0x80E3
+#define GL_COLOR_INDEX4_EXT 0x80E4
+#define GL_COLOR_INDEX8_EXT 0x80E5
+#define GL_COLOR_INDEX12_EXT 0x80E6
+#define GL_COLOR_INDEX16_EXT 0x80E7
+#ifndef GL_EXT_clip_volume_hint
+#ifndef GL_SGIX_list_priority
+#define GL_LIST_PRIORITY_SGIX 0x8182
+#ifndef GL_SGIX_ir_instrument1
+#define GL_IR_INSTRUMENT1_SGIX 0x817F
+#ifndef GL_SGIX_calligraphic_fragment
+#ifndef GL_SGIX_texture_lod_bias
+#define GL_TEXTURE_LOD_BIAS_R_SGIX 0x8190
+#ifndef GL_SGIX_shadow_ambient
+#ifndef GL_EXT_index_texture
+#ifndef GL_EXT_index_material
+#ifndef GL_EXT_index_func
+#define GL_INDEX_TEST_EXT 0x81B5
+#define GL_INDEX_TEST_FUNC_EXT 0x81B6
+#define GL_INDEX_TEST_REF_EXT 0x81B7
+#ifndef GL_EXT_index_array_formats
+#define GL_IUI_V2F_EXT 0x81AD
+#define GL_IUI_V3F_EXT 0x81AE
+#define GL_IUI_N3F_V2F_EXT 0x81AF
+#define GL_IUI_N3F_V3F_EXT 0x81B0
+#define GL_T2F_IUI_V2F_EXT 0x81B1
+#define GL_T2F_IUI_V3F_EXT 0x81B2
+#define GL_T2F_IUI_N3F_V2F_EXT 0x81B3
+#define GL_T2F_IUI_N3F_V3F_EXT 0x81B4
+#ifndef GL_EXT_compiled_vertex_array
+#ifndef GL_EXT_cull_vertex
+#define GL_CULL_VERTEX_EXT 0x81AA
+#ifndef GL_SGIX_ycrcb
+#define GL_YCRCB_422_SGIX 0x81BB
+#define GL_YCRCB_444_SGIX 0x81BC
+#ifndef GL_SGIX_fragment_lighting
+#define GL_LIGHT_ENV_MODE_SGIX 0x8407
+#define GL_FRAGMENT_LIGHT4_SGIX 0x8410
+#define GL_FRAGMENT_LIGHT5_SGIX 0x8411
+#define GL_FRAGMENT_LIGHT6_SGIX 0x8412
+#define GL_FRAGMENT_LIGHT7_SGIX 0x8413
+#ifndef GL_IBM_rasterpos_clip
+#ifndef GL_HP_texture_lighting
+#ifndef GL_EXT_draw_range_elements
+#ifndef GL_WIN_phong_shading
+#define GL_PHONG_WIN 0x80EA
+#define GL_PHONG_HINT_WIN 0x80EB
+#ifndef GL_WIN_specular_fog
+#ifndef GL_EXT_light_texture
+#define GL_ATTENUATION_EXT 0x834D
+#define GL_TEXTURE_LIGHT_EXT 0x8350
+#ifndef GL_SGIX_blend_alpha_minmax
+#define GL_ALPHA_MIN_SGIX 0x8320
+#define GL_ALPHA_MAX_SGIX 0x8321
+#ifndef GL_SGIX_impact_pixel_texture
+#ifndef GL_EXT_bgra
+#define GL_BGR_EXT 0x80E0
+#define GL_BGRA_EXT 0x80E1
+#ifndef GL_SGIX_async
+#define GL_ASYNC_MARKER_SGIX 0x8329
+#ifndef GL_SGIX_async_pixel
+#ifndef GL_SGIX_async_histogram
+#ifndef GL_INTEL_texture_scissor
+#ifndef GL_INTEL_parallel_arrays
+#ifndef GL_HP_occlusion_test
+#define GL_OCCLUSION_TEST_HP 0x8165
+#ifndef GL_EXT_pixel_transform
+#define GL_PIXEL_TRANSFORM_2D_EXT 0x8330
+#define GL_PIXEL_MAG_FILTER_EXT 0x8331
+#define GL_PIXEL_MIN_FILTER_EXT 0x8332
+#define GL_CUBIC_EXT 0x8334
+#define GL_AVERAGE_EXT 0x8335
+#ifndef GL_EXT_pixel_transform_color_table
+#ifndef GL_EXT_shared_texture_palette
+#ifndef GL_EXT_separate_specular_color
+#define GL_SINGLE_COLOR_EXT 0x81F9
+#ifndef GL_EXT_secondary_color
+#define GL_COLOR_SUM_EXT 0x8458
+#ifndef GL_EXT_texture_perturb_normal
+#define GL_PERTURB_EXT 0x85AE
+#ifndef GL_EXT_multi_draw_arrays
+#ifndef GL_EXT_fog_coord
+#define GL_FOG_COORDINATE_EXT 0x8451
+#define GL_FRAGMENT_DEPTH_EXT 0x8452
+#ifndef GL_REND_screen_coordinates
+#ifndef GL_EXT_coordinate_frame
+#define GL_TANGENT_ARRAY_EXT 0x8439
+#define GL_MAP1_TANGENT_EXT 0x8444
+#define GL_MAP2_TANGENT_EXT 0x8445
+#define GL_MAP1_BINORMAL_EXT 0x8446
+#define GL_MAP2_BINORMAL_EXT 0x8447
+#ifndef GL_EXT_texture_env_combine
+#define GL_COMBINE_EXT 0x8570
+#define GL_COMBINE_RGB_EXT 0x8571
+#define GL_COMBINE_ALPHA_EXT 0x8572
+#define GL_RGB_SCALE_EXT 0x8573
+#define GL_ADD_SIGNED_EXT 0x8574
+#define GL_INTERPOLATE_EXT 0x8575
+#define GL_CONSTANT_EXT 0x8576
+#define GL_PRIMARY_COLOR_EXT 0x8577
+#define GL_PREVIOUS_EXT 0x8578
+#define GL_SOURCE0_RGB_EXT 0x8580
+#define GL_SOURCE1_RGB_EXT 0x8581
+#define GL_SOURCE2_RGB_EXT 0x8582
+#define GL_SOURCE0_ALPHA_EXT 0x8588
+#define GL_SOURCE1_ALPHA_EXT 0x8589
+#define GL_SOURCE2_ALPHA_EXT 0x858A
+#define GL_OPERAND0_RGB_EXT 0x8590
+#define GL_OPERAND1_RGB_EXT 0x8591
+#define GL_OPERAND2_RGB_EXT 0x8592
+#define GL_OPERAND0_ALPHA_EXT 0x8598
+#define GL_OPERAND1_ALPHA_EXT 0x8599
+#define GL_OPERAND2_ALPHA_EXT 0x859A
+#ifndef GL_APPLE_specular_vector
+#ifndef GL_APPLE_transform_hint
+#ifndef GL_SGIX_fog_scale
+#define GL_FOG_SCALE_SGIX 0x81FC
+#ifndef GL_SUNX_constant_data
+#ifndef GL_SUN_global_alpha
+#define GL_GLOBAL_ALPHA_SUN 0x81D9
+#ifndef GL_SUN_triangle_list
+#define GL_RESTART_SUN 0x0001
+#define GL_REPLACE_MIDDLE_SUN 0x0002
+#define GL_REPLACE_OLDEST_SUN 0x0003
+#define GL_TRIANGLE_LIST_SUN 0x81D7
+#define GL_R1UI_V3F_SUN 0x85C4
+#define GL_R1UI_C4UB_V3F_SUN 0x85C5
+#define GL_R1UI_C3F_V3F_SUN 0x85C6
+#define GL_R1UI_N3F_V3F_SUN 0x85C7
+#define GL_R1UI_C4F_N3F_V3F_SUN 0x85C8
+#define GL_R1UI_T2F_V3F_SUN 0x85C9
+#define GL_R1UI_T2F_N3F_V3F_SUN 0x85CA
+#define GL_R1UI_T2F_C4F_N3F_V3F_SUN 0x85CB
+#ifndef GL_SUN_vertex
+#ifndef GL_EXT_blend_func_separate
+#define GL_BLEND_DST_RGB_EXT 0x80C8
+#define GL_BLEND_SRC_RGB_EXT 0x80C9
+#ifndef GL_INGR_color_clamp
+#define GL_RED_MIN_CLAMP_INGR 0x8560
+#define GL_GREEN_MIN_CLAMP_INGR 0x8561
+#define GL_BLUE_MIN_CLAMP_INGR 0x8562
+#define GL_ALPHA_MIN_CLAMP_INGR 0x8563
+#define GL_RED_MAX_CLAMP_INGR 0x8564
+#define GL_GREEN_MAX_CLAMP_INGR 0x8565
+#define GL_BLUE_MAX_CLAMP_INGR 0x8566
+#define GL_ALPHA_MAX_CLAMP_INGR 0x8567
+#ifndef GL_INGR_interlace_read
+#define GL_INTERLACE_READ_INGR 0x8568
+#ifndef GL_EXT_stencil_wrap
+#define GL_INCR_WRAP_EXT 0x8507
+#define GL_DECR_WRAP_EXT 0x8508
+#ifndef GL_EXT_422_pixels
+#define GL_422_EXT 0x80CC
+#define GL_422_REV_EXT 0x80CD
+#define GL_422_AVERAGE_EXT 0x80CE
+#define GL_422_REV_AVERAGE_EXT 0x80CF
+#ifndef GL_NV_texgen_reflection
+#define GL_NORMAL_MAP_NV 0x8511
+#define GL_REFLECTION_MAP_NV 0x8512
+#ifndef GL_EXT_texture_cube_map
+#define GL_NORMAL_MAP_EXT 0x8511
+#define GL_REFLECTION_MAP_EXT 0x8512
+#define GL_TEXTURE_CUBE_MAP_EXT 0x8513
+#ifndef GL_SUN_convolution_border_modes
+#define GL_WRAP_BORDER_SUN 0x81D4
+#ifndef GL_EXT_texture_env_add
+#ifndef GL_EXT_texture_lod_bias
+#define GL_TEXTURE_LOD_BIAS_EXT 0x8501
+#ifndef GL_EXT_texture_filter_anisotropic
+#ifndef GL_EXT_vertex_weighting
+#define GL_MODELVIEW1_MATRIX_EXT 0x8506
+#define GL_MODELVIEW1_EXT 0x850A
+#ifndef GL_NV_light_max_exponent
+#define GL_MAX_SHININESS_NV 0x8504
+#define GL_MAX_SPOT_EXPONENT_NV 0x8505
+#ifndef GL_NV_vertex_array_range
+#ifndef GL_NV_register_combiners
+#define GL_VARIABLE_A_NV 0x8523
+#define GL_VARIABLE_B_NV 0x8524
+#define GL_VARIABLE_C_NV 0x8525
+#define GL_VARIABLE_D_NV 0x8526
+#define GL_VARIABLE_E_NV 0x8527
+#define GL_VARIABLE_F_NV 0x8528
+#define GL_VARIABLE_G_NV 0x8529
+#define GL_CONSTANT_COLOR0_NV 0x852A
+#define GL_CONSTANT_COLOR1_NV 0x852B
+#define GL_PRIMARY_COLOR_NV 0x852C
+#define GL_SPARE0_NV 0x852E
+#define GL_SPARE1_NV 0x852F
+#define GL_DISCARD_NV 0x8530
+#define GL_E_TIMES_F_NV 0x8531
+#define GL_UNSIGNED_INVERT_NV 0x8537
+#define GL_EXPAND_NORMAL_NV 0x8538
+#define GL_EXPAND_NEGATE_NV 0x8539
+#define GL_HALF_BIAS_NORMAL_NV 0x853A
+#define GL_HALF_BIAS_NEGATE_NV 0x853B
+#define GL_SIGNED_NEGATE_NV 0x853D
+#define GL_SCALE_BY_TWO_NV 0x853E
+#define GL_SCALE_BY_FOUR_NV 0x853F
+#define GL_SCALE_BY_ONE_HALF_NV 0x8540
+#define GL_COMBINER_INPUT_NV 0x8542
+#define GL_COMBINER_MAPPING_NV 0x8543
+#define GL_COMBINER_MUX_SUM_NV 0x8547
+#define GL_COMBINER_SCALE_NV 0x8548
+#define GL_COMBINER_BIAS_NV 0x8549
+#define GL_COLOR_SUM_CLAMP_NV 0x854F
+#define GL_COMBINER0_NV 0x8550
+#define GL_COMBINER1_NV 0x8551
+#define GL_COMBINER2_NV 0x8552
+#define GL_COMBINER3_NV 0x8553
+#define GL_COMBINER4_NV 0x8554
+#define GL_COMBINER5_NV 0x8555
+#define GL_COMBINER6_NV 0x8556
+#define GL_COMBINER7_NV 0x8557
+/* reuse GL_TEXTURE0_ARB */
+/* reuse GL_TEXTURE1_ARB */
+/* reuse GL_ZERO */
+/* reuse GL_NONE */
+/* reuse GL_FOG */
+#ifndef GL_NV_fog_distance
+#define GL_EYE_RADIAL_NV 0x855B
+/* reuse GL_EYE_PLANE */
+#ifndef GL_NV_texgen_emboss
+#define GL_EMBOSS_LIGHT_NV 0x855D
+#define GL_EMBOSS_MAP_NV 0x855F
+#ifndef GL_NV_blend_square
+#ifndef GL_NV_texture_env_combine4
+#define GL_COMBINE4_NV 0x8503
+#define GL_SOURCE3_RGB_NV 0x8583
+#define GL_SOURCE3_ALPHA_NV 0x858B
+#define GL_OPERAND3_RGB_NV 0x8593
+#define GL_OPERAND3_ALPHA_NV 0x859B
+#ifndef GL_MESA_resize_buffers
+#ifndef GL_MESA_window_pos
+#ifndef GL_EXT_texture_compression_s3tc
+#ifndef GL_IBM_cull_vertex
+#define GL_CULL_VERTEX_IBM 103050
+#ifndef GL_IBM_multimode_draw_arrays
+#ifndef GL_IBM_vertex_array_lists
+#define GL_VERTEX_ARRAY_LIST_IBM 103070
+#define GL_NORMAL_ARRAY_LIST_IBM 103071
+#define GL_COLOR_ARRAY_LIST_IBM 103072
+#define GL_INDEX_ARRAY_LIST_IBM 103073
+#ifndef GL_SGIX_subsample
+#define GL_PIXEL_SUBSAMPLE_4444_SGIX 0x85A2
+#define GL_PIXEL_SUBSAMPLE_2424_SGIX 0x85A3
+#define GL_PIXEL_SUBSAMPLE_4242_SGIX 0x85A4
+#ifndef GL_SGIX_ycrcb_subsample
+#ifndef GL_SGIX_ycrcba
+#define GL_YCRCB_SGIX 0x8318
+#define GL_YCRCBA_SGIX 0x8319
+#ifndef GL_SGI_depth_pass_instrument
+#ifndef GL_3DFX_texture_compression_FXT1
+#ifndef GL_3DFX_multisample
+#define GL_MULTISAMPLE_3DFX 0x86B2
+#define GL_SAMPLE_BUFFERS_3DFX 0x86B3
+#define GL_SAMPLES_3DFX 0x86B4
+#define GL_MULTISAMPLE_BIT_3DFX 0x20000000
+#ifndef GL_3DFX_tbuffer
+#ifndef GL_EXT_multisample
+#define GL_MULTISAMPLE_EXT 0x809D
+#define GL_SAMPLE_MASK_EXT 0x80A0
+#define GL_1PASS_EXT 0x80A1
+#define GL_2PASS_0_EXT 0x80A2
+#define GL_2PASS_1_EXT 0x80A3
+#define GL_4PASS_0_EXT 0x80A4
+#define GL_4PASS_1_EXT 0x80A5
+#define GL_4PASS_2_EXT 0x80A6
+#define GL_4PASS_3_EXT 0x80A7
+#define GL_SAMPLES_EXT 0x80A9
+#define GL_MULTISAMPLE_BIT_EXT 0x20000000
+#ifndef GL_SGIX_vertex_preclip
+#ifndef GL_SGIX_convolution_accuracy
+#ifndef GL_SGIX_resample
+#ifndef GL_SGIS_point_line_texgen
+#define GL_EYE_POINT_SGIS 0x81F4
+#define GL_OBJECT_POINT_SGIS 0x81F5
+#define GL_EYE_LINE_SGIS 0x81F6
+#define GL_OBJECT_LINE_SGIS 0x81F7
+#ifndef GL_SGIS_texture_color_mask
+#ifndef GL_EXT_texture_env_dot3
+#define GL_DOT3_RGB_EXT 0x8740
+#define GL_DOT3_RGBA_EXT 0x8741
+#ifndef GL_ATI_texture_mirror_once
+#define GL_MIRROR_CLAMP_ATI 0x8742
+#ifndef GL_NV_fence
+#define GL_ALL_COMPLETED_NV 0x84F2
+#define GL_FENCE_STATUS_NV 0x84F3
+#ifndef GL_IBM_texture_mirrored_repeat
+#define GL_MIRRORED_REPEAT_IBM 0x8370
+#ifndef GL_NV_evaluators
+#define GL_EVAL_2D_NV 0x86C0
+#define GL_EVAL_TRIANGULAR_2D_NV 0x86C1
+#define GL_MAP_ATTRIB_U_ORDER_NV 0x86C3
+#define GL_MAP_ATTRIB_V_ORDER_NV 0x86C4
+#define GL_EVAL_VERTEX_ATTRIB10_NV 0x86D0
+#define GL_EVAL_VERTEX_ATTRIB11_NV 0x86D1
+#define GL_EVAL_VERTEX_ATTRIB12_NV 0x86D2
+#define GL_EVAL_VERTEX_ATTRIB13_NV 0x86D3
+#define GL_EVAL_VERTEX_ATTRIB14_NV 0x86D4
+#define GL_EVAL_VERTEX_ATTRIB15_NV 0x86D5
+#ifndef GL_NV_packed_depth_stencil
+#define GL_DEPTH_STENCIL_NV 0x84F9
+#define GL_UNSIGNED_INT_24_8_NV 0x84FA
+#ifndef GL_NV_register_combiners2
+#ifndef GL_NV_texture_compression_vtc
+#ifndef GL_NV_texture_rectangle
+#ifndef GL_NV_texture_shader
+#define GL_UNSIGNED_INT_S8_S8_8_8_NV 0x86DA
+#define GL_UNSIGNED_INT_8_8_S8_S8_REV_NV 0x86DB
+#define GL_CULL_MODES_NV 0x86E0
+#define GL_CONST_EYE_NV 0x86E5
+#define GL_PASS_THROUGH_NV 0x86E6
+#define GL_CULL_FRAGMENT_NV 0x86E7
+#define GL_OFFSET_TEXTURE_2D_NV 0x86E8
+#define GL_DOT_PRODUCT_NV 0x86EC
+#define GL_HILO_NV 0x86F4
+#define GL_DSDT_NV 0x86F5
+#define GL_DSDT_MAG_NV 0x86F6
+#define GL_DSDT_MAG_VIB_NV 0x86F7
+#define GL_HILO16_NV 0x86F8
+#define GL_SIGNED_HILO_NV 0x86F9
+#define GL_SIGNED_HILO16_NV 0x86FA
+#define GL_SIGNED_RGBA_NV 0x86FB
+#define GL_SIGNED_RGBA8_NV 0x86FC
+#define GL_SIGNED_RGB_NV 0x86FE
+#define GL_SIGNED_RGB8_NV 0x86FF
+#define GL_SIGNED_LUMINANCE_NV 0x8701
+#define GL_SIGNED_LUMINANCE8_NV 0x8702
+#define GL_SIGNED_ALPHA_NV 0x8705
+#define GL_SIGNED_ALPHA8_NV 0x8706
+#define GL_SIGNED_INTENSITY_NV 0x8707
+#define GL_SIGNED_INTENSITY8_NV 0x8708
+#define GL_DSDT8_NV 0x8709
+#define GL_DSDT8_MAG8_NV 0x870A
+#define GL_DSDT8_MAG8_INTENSITY8_NV 0x870B
+#define GL_HI_SCALE_NV 0x870E
+#define GL_LO_SCALE_NV 0x870F
+#define GL_DS_SCALE_NV 0x8710
+#define GL_DT_SCALE_NV 0x8711
+#define GL_MAGNITUDE_SCALE_NV 0x8712
+#define GL_VIBRANCE_SCALE_NV 0x8713
+#define GL_HI_BIAS_NV 0x8714
+#define GL_LO_BIAS_NV 0x8715
+#define GL_DS_BIAS_NV 0x8716
+#define GL_DT_BIAS_NV 0x8717
+#define GL_MAGNITUDE_BIAS_NV 0x8718
+#define GL_VIBRANCE_BIAS_NV 0x8719
+#define GL_TEXTURE_HI_SIZE_NV 0x871B
+#define GL_TEXTURE_LO_SIZE_NV 0x871C
+#define GL_TEXTURE_DS_SIZE_NV 0x871D
+#define GL_TEXTURE_DT_SIZE_NV 0x871E
+#define GL_TEXTURE_MAG_SIZE_NV 0x871F
+#ifndef GL_NV_texture_shader2
+#ifndef GL_NV_vertex_array_range2
+#ifndef GL_NV_vertex_program
+#define GL_VERTEX_PROGRAM_NV 0x8620
+#define GL_ATTRIB_ARRAY_SIZE_NV 0x8623
+#define GL_ATTRIB_ARRAY_TYPE_NV 0x8625
+#define GL_CURRENT_ATTRIB_NV 0x8626
+#define GL_PROGRAM_LENGTH_NV 0x8627
+#define GL_PROGRAM_STRING_NV 0x8628
+#define GL_IDENTITY_NV 0x862A
+#define GL_INVERSE_NV 0x862B
+#define GL_TRANSPOSE_NV 0x862C
+#define GL_MATRIX0_NV 0x8630
+#define GL_MATRIX1_NV 0x8631
+#define GL_MATRIX2_NV 0x8632
+#define GL_MATRIX3_NV 0x8633
+#define GL_MATRIX4_NV 0x8634
+#define GL_MATRIX5_NV 0x8635
+#define GL_MATRIX6_NV 0x8636
+#define GL_MATRIX7_NV 0x8637
+#define GL_CURRENT_MATRIX_NV 0x8641
+#define GL_PROGRAM_TARGET_NV 0x8646
+#define GL_PROGRAM_RESIDENT_NV 0x8647
+#define GL_TRACK_MATRIX_NV 0x8648
+#define GL_VERTEX_ATTRIB_ARRAY0_NV 0x8650
+#define GL_VERTEX_ATTRIB_ARRAY1_NV 0x8651
+#define GL_VERTEX_ATTRIB_ARRAY2_NV 0x8652
+#define GL_VERTEX_ATTRIB_ARRAY3_NV 0x8653
+#define GL_VERTEX_ATTRIB_ARRAY4_NV 0x8654
+#define GL_VERTEX_ATTRIB_ARRAY5_NV 0x8655
+#define GL_VERTEX_ATTRIB_ARRAY6_NV 0x8656
+#define GL_VERTEX_ATTRIB_ARRAY7_NV 0x8657
+#define GL_VERTEX_ATTRIB_ARRAY8_NV 0x8658
+#define GL_VERTEX_ATTRIB_ARRAY9_NV 0x8659
+#define GL_MAP1_VERTEX_ATTRIB0_4_NV 0x8660
+#define GL_MAP1_VERTEX_ATTRIB1_4_NV 0x8661
+#define GL_MAP1_VERTEX_ATTRIB2_4_NV 0x8662
+#define GL_MAP1_VERTEX_ATTRIB3_4_NV 0x8663
+#define GL_MAP1_VERTEX_ATTRIB4_4_NV 0x8664
+#define GL_MAP1_VERTEX_ATTRIB5_4_NV 0x8665
+#define GL_MAP1_VERTEX_ATTRIB6_4_NV 0x8666
+#define GL_MAP1_VERTEX_ATTRIB7_4_NV 0x8667
+#define GL_MAP1_VERTEX_ATTRIB8_4_NV 0x8668
+#define GL_MAP1_VERTEX_ATTRIB9_4_NV 0x8669
+#define GL_MAP1_VERTEX_ATTRIB10_4_NV 0x866A
+#define GL_MAP1_VERTEX_ATTRIB11_4_NV 0x866B
+#define GL_MAP1_VERTEX_ATTRIB12_4_NV 0x866C
+#define GL_MAP1_VERTEX_ATTRIB13_4_NV 0x866D
+#define GL_MAP1_VERTEX_ATTRIB14_4_NV 0x866E
+#define GL_MAP1_VERTEX_ATTRIB15_4_NV 0x866F
+#define GL_MAP2_VERTEX_ATTRIB0_4_NV 0x8670
+#define GL_MAP2_VERTEX_ATTRIB1_4_NV 0x8671
+#define GL_MAP2_VERTEX_ATTRIB2_4_NV 0x8672
+#define GL_MAP2_VERTEX_ATTRIB3_4_NV 0x8673
+#define GL_MAP2_VERTEX_ATTRIB4_4_NV 0x8674
+#define GL_MAP2_VERTEX_ATTRIB5_4_NV 0x8675
+#define GL_MAP2_VERTEX_ATTRIB6_4_NV 0x8676
+#define GL_MAP2_VERTEX_ATTRIB7_4_NV 0x8677
+#define GL_MAP2_VERTEX_ATTRIB8_4_NV 0x8678
+#define GL_MAP2_VERTEX_ATTRIB9_4_NV 0x8679
+#define GL_MAP2_VERTEX_ATTRIB10_4_NV 0x867A
+#define GL_MAP2_VERTEX_ATTRIB11_4_NV 0x867B
+#define GL_MAP2_VERTEX_ATTRIB12_4_NV 0x867C
+#define GL_MAP2_VERTEX_ATTRIB13_4_NV 0x867D
+#define GL_MAP2_VERTEX_ATTRIB14_4_NV 0x867E
+#define GL_MAP2_VERTEX_ATTRIB15_4_NV 0x867F
+#ifndef GL_SGIX_texture_coordinate_clamp
+#ifndef GL_SGIX_scalebias_hint
+#define GL_SCALEBIAS_HINT_SGIX 0x8322
+#ifndef GL_OML_interlace
+#define GL_INTERLACE_OML 0x8980
+#define GL_INTERLACE_READ_OML 0x8981
+#ifndef GL_OML_subsample
+#define GL_FORMAT_SUBSAMPLE_24_24_OML 0x8982
+#define GL_FORMAT_SUBSAMPLE_244_244_OML 0x8983
+#ifndef GL_OML_resample
+#define GL_PACK_RESAMPLE_OML 0x8984
+#define GL_UNPACK_RESAMPLE_OML 0x8985
+#ifndef GL_NV_copy_depth_to_color
+#ifndef GL_ATI_envmap_bumpmap
+#define GL_BUMP_ROT_MATRIX_ATI 0x8775
+#define GL_BUMP_NUM_TEX_UNITS_ATI 0x8777
+#define GL_BUMP_TEX_UNITS_ATI 0x8778
+#define GL_DUDV_ATI 0x8779
+#define GL_DU8DV8_ATI 0x877A
+#define GL_BUMP_ENVMAP_ATI 0x877B
+#define GL_BUMP_TARGET_ATI 0x877C
+#ifndef GL_ATI_fragment_shader
+#define GL_FRAGMENT_SHADER_ATI 0x8920
+#define GL_REG_0_ATI 0x8921
+#define GL_REG_1_ATI 0x8922
+#define GL_REG_2_ATI 0x8923
+#define GL_REG_3_ATI 0x8924
+#define GL_REG_4_ATI 0x8925
+#define GL_REG_5_ATI 0x8926
+#define GL_REG_6_ATI 0x8927
+#define GL_REG_7_ATI 0x8928
+#define GL_REG_8_ATI 0x8929
+#define GL_REG_9_ATI 0x892A
+#define GL_REG_10_ATI 0x892B
+#define GL_REG_11_ATI 0x892C
+#define GL_REG_12_ATI 0x892D
+#define GL_REG_13_ATI 0x892E
+#define GL_REG_14_ATI 0x892F
+#define GL_REG_15_ATI 0x8930
+#define GL_REG_16_ATI 0x8931
+#define GL_REG_17_ATI 0x8932
+#define GL_REG_18_ATI 0x8933
+#define GL_REG_19_ATI 0x8934
+#define GL_REG_20_ATI 0x8935
+#define GL_REG_21_ATI 0x8936
+#define GL_REG_22_ATI 0x8937
+#define GL_REG_23_ATI 0x8938
+#define GL_REG_24_ATI 0x8939
+#define GL_REG_25_ATI 0x893A
+#define GL_REG_26_ATI 0x893B
+#define GL_REG_27_ATI 0x893C
+#define GL_REG_28_ATI 0x893D
+#define GL_REG_29_ATI 0x893E
+#define GL_REG_30_ATI 0x893F
+#define GL_REG_31_ATI 0x8940
+#define GL_CON_0_ATI 0x8941
+#define GL_CON_1_ATI 0x8942
+#define GL_CON_2_ATI 0x8943
+#define GL_CON_3_ATI 0x8944
+#define GL_CON_4_ATI 0x8945
+#define GL_CON_5_ATI 0x8946
+#define GL_CON_6_ATI 0x8947
+#define GL_CON_7_ATI 0x8948
+#define GL_CON_8_ATI 0x8949
+#define GL_CON_9_ATI 0x894A
+#define GL_CON_10_ATI 0x894B
+#define GL_CON_11_ATI 0x894C
+#define GL_CON_12_ATI 0x894D
+#define GL_CON_13_ATI 0x894E
+#define GL_CON_14_ATI 0x894F
+#define GL_CON_15_ATI 0x8950
+#define GL_CON_16_ATI 0x8951
+#define GL_CON_17_ATI 0x8952
+#define GL_CON_18_ATI 0x8953
+#define GL_CON_19_ATI 0x8954
+#define GL_CON_20_ATI 0x8955
+#define GL_CON_21_ATI 0x8956
+#define GL_CON_22_ATI 0x8957
+#define GL_CON_23_ATI 0x8958
+#define GL_CON_24_ATI 0x8959
+#define GL_CON_25_ATI 0x895A
+#define GL_CON_26_ATI 0x895B
+#define GL_CON_27_ATI 0x895C
+#define GL_CON_28_ATI 0x895D
+#define GL_CON_29_ATI 0x895E
+#define GL_CON_30_ATI 0x895F
+#define GL_CON_31_ATI 0x8960
+#define GL_MOV_ATI 0x8961
+#define GL_ADD_ATI 0x8963
+#define GL_MUL_ATI 0x8964
+#define GL_SUB_ATI 0x8965
+#define GL_DOT3_ATI 0x8966
+#define GL_DOT4_ATI 0x8967
+#define GL_MAD_ATI 0x8968
+#define GL_LERP_ATI 0x8969
+#define GL_CND_ATI 0x896A
+#define GL_CND0_ATI 0x896B
+#define GL_DOT2_ADD_ATI 0x896C
+#define GL_NUM_PASSES_ATI 0x8970
+#define GL_SWIZZLE_STR_ATI 0x8976
+#define GL_SWIZZLE_STQ_ATI 0x8977
+#define GL_SWIZZLE_STR_DR_ATI 0x8978
+#define GL_SWIZZLE_STQ_DQ_ATI 0x8979
+#define GL_SWIZZLE_STRQ_ATI 0x897A
+#define GL_SWIZZLE_STRQ_DQ_ATI 0x897B
+#define GL_RED_BIT_ATI 0x00000001
+#define GL_GREEN_BIT_ATI 0x00000002
+#define GL_BLUE_BIT_ATI 0x00000004
+#define GL_2X_BIT_ATI 0x00000001
+#define GL_4X_BIT_ATI 0x00000002
+#define GL_8X_BIT_ATI 0x00000004
+#define GL_HALF_BIT_ATI 0x00000008
+#define GL_QUARTER_BIT_ATI 0x00000010
+#define GL_EIGHTH_BIT_ATI 0x00000020
+#define GL_SATURATE_BIT_ATI 0x00000040
+#define GL_COMP_BIT_ATI 0x00000002
+#define GL_NEGATE_BIT_ATI 0x00000004
+#define GL_BIAS_BIT_ATI 0x00000008
+#ifndef GL_ATI_pn_triangles
+#define GL_PN_TRIANGLES_ATI 0x87F0
+#ifndef GL_ATI_vertex_array_object
+#define GL_STATIC_ATI 0x8760
+#define GL_DYNAMIC_ATI 0x8761
+#define GL_PRESERVE_ATI 0x8762
+#define GL_DISCARD_ATI 0x8763
+#ifndef GL_EXT_vertex_shader
+#define GL_VERTEX_SHADER_EXT 0x8780
+#define GL_OP_INDEX_EXT 0x8782
+#define GL_OP_NEGATE_EXT 0x8783
+#define GL_OP_DOT3_EXT 0x8784
+#define GL_OP_DOT4_EXT 0x8785
+#define GL_OP_MUL_EXT 0x8786
+#define GL_OP_ADD_EXT 0x8787
+#define GL_OP_MADD_EXT 0x8788
+#define GL_OP_FRAC_EXT 0x8789
+#define GL_OP_MAX_EXT 0x878A
+#define GL_OP_MIN_EXT 0x878B
+#define GL_OP_SET_GE_EXT 0x878C
+#define GL_OP_SET_LT_EXT 0x878D
+#define GL_OP_CLAMP_EXT 0x878E
+#define GL_OP_FLOOR_EXT 0x878F
+#define GL_OP_ROUND_EXT 0x8790
+#define GL_OP_EXP_BASE_2_EXT 0x8791
+#define GL_OP_LOG_BASE_2_EXT 0x8792
+#define GL_OP_POWER_EXT 0x8793
+#define GL_OP_RECIP_EXT 0x8794
+#define GL_OP_RECIP_SQRT_EXT 0x8795
+#define GL_OP_SUB_EXT 0x8796
+#define GL_OP_CROSS_PRODUCT_EXT 0x8797
+#define GL_OP_MOV_EXT 0x8799
+#define GL_OUTPUT_VERTEX_EXT 0x879A
+#define GL_OUTPUT_COLOR0_EXT 0x879B
+#define GL_OUTPUT_COLOR1_EXT 0x879C
+#define GL_OUTPUT_FOG_EXT 0x87BD
+#define GL_SCALAR_EXT 0x87BE
+#define GL_VECTOR_EXT 0x87BF
+#define GL_MATRIX_EXT 0x87C0
+#define GL_VARIANT_EXT 0x87C1
+#define GL_INVARIANT_EXT 0x87C2
+#define GL_LOCAL_EXT 0x87C4
+#define GL_X_EXT 0x87D5
+#define GL_Y_EXT 0x87D6
+#define GL_Z_EXT 0x87D7
+#define GL_W_EXT 0x87D8
+#define GL_NEGATIVE_X_EXT 0x87D9
+#define GL_NEGATIVE_Y_EXT 0x87DA
+#define GL_NEGATIVE_Z_EXT 0x87DB
+#define GL_NEGATIVE_W_EXT 0x87DC
+#define GL_ZERO_EXT 0x87DD
+#define GL_ONE_EXT 0x87DE
+#define GL_FULL_RANGE_EXT 0x87E1
+#define GL_MVP_MATRIX_EXT 0x87E3
+#define GL_VARIANT_VALUE_EXT 0x87E4
+#define GL_VARIANT_ARRAY_EXT 0x87E8
+#ifndef GL_ATI_vertex_streams
+#define GL_VERTEX_STREAM0_ATI 0x876C
+#define GL_VERTEX_STREAM1_ATI 0x876D
+#define GL_VERTEX_STREAM2_ATI 0x876E
+#define GL_VERTEX_STREAM3_ATI 0x876F
+#define GL_VERTEX_STREAM4_ATI 0x8770
+#define GL_VERTEX_STREAM5_ATI 0x8771
+#define GL_VERTEX_STREAM6_ATI 0x8772
+#define GL_VERTEX_STREAM7_ATI 0x8773
+#define GL_VERTEX_SOURCE_ATI 0x8774
+#ifndef GL_ATI_element_array
+#define GL_ELEMENT_ARRAY_ATI 0x8768
+#ifndef GL_SUN_mesh_array
+#define GL_QUAD_MESH_SUN 0x8614
+#define GL_TRIANGLE_MESH_SUN 0x8615
+#ifndef GL_SUN_slice_accum
+#define GL_SLICE_ACCUM_SUN 0x85CC
+#ifndef GL_NV_multisample_filter_hint
+#ifndef GL_NV_depth_clamp
+#define GL_DEPTH_CLAMP_NV 0x864F
+#ifndef GL_NV_occlusion_query
+#define GL_PIXEL_COUNTER_BITS_NV 0x8864
+#define GL_PIXEL_COUNT_NV 0x8866
+#ifndef GL_NV_point_sprite
+#define GL_POINT_SPRITE_NV 0x8861
+#define GL_COORD_REPLACE_NV 0x8862
+#define GL_POINT_SPRITE_R_MODE_NV 0x8863
+#ifndef GL_NV_texture_shader3
+#define GL_OFFSET_HILO_TEXTURE_2D_NV 0x8854
+#define GL_HILO8_NV 0x885E
+#define GL_SIGNED_HILO8_NV 0x885F
+#define GL_FORCE_BLUE_TO_ONE_NV 0x8860
+#ifndef GL_NV_vertex_program1_1
+#ifndef GL_EXT_shadow_funcs
+#ifndef GL_EXT_stencil_two_side
+#ifndef GL_ATI_text_fragment_shader
+#ifndef GL_APPLE_client_storage
+#ifndef GL_APPLE_element_array
+#define GL_ELEMENT_ARRAY_APPLE 0x8768
+#ifndef GL_APPLE_fence
+#define GL_FENCE_APPLE 0x8A0B
+#ifndef GL_APPLE_vertex_array_object
+#ifndef GL_APPLE_vertex_array_range
+#ifndef GL_APPLE_ycbcr_422
+#define GL_YCBCR_422_APPLE 0x85B9
+#ifndef GL_S3_s3tc
+#define GL_RGB_S3TC 0x83A0
+#define GL_RGB4_S3TC 0x83A1
+#define GL_RGBA_S3TC 0x83A2
+#define GL_RGBA4_S3TC 0x83A3
+#ifndef GL_ATI_draw_buffers
+#define GL_MAX_DRAW_BUFFERS_ATI 0x8824
+#define GL_DRAW_BUFFER0_ATI 0x8825
+#define GL_DRAW_BUFFER1_ATI 0x8826
+#define GL_DRAW_BUFFER2_ATI 0x8827
+#define GL_DRAW_BUFFER3_ATI 0x8828
+#define GL_DRAW_BUFFER4_ATI 0x8829
+#define GL_DRAW_BUFFER5_ATI 0x882A
+#define GL_DRAW_BUFFER6_ATI 0x882B
+#define GL_DRAW_BUFFER7_ATI 0x882C
+#define GL_DRAW_BUFFER8_ATI 0x882D
+#define GL_DRAW_BUFFER9_ATI 0x882E
+#define GL_DRAW_BUFFER10_ATI 0x882F
+#define GL_DRAW_BUFFER11_ATI 0x8830
+#define GL_DRAW_BUFFER12_ATI 0x8831
+#define GL_DRAW_BUFFER13_ATI 0x8832
+#define GL_DRAW_BUFFER14_ATI 0x8833
+#define GL_DRAW_BUFFER15_ATI 0x8834
+#ifndef GL_ATI_pixel_format_float
+#define GL_TYPE_RGBA_FLOAT_ATI 0x8820
+#ifndef GL_ATI_texture_env_combine3
+#define GL_MODULATE_ADD_ATI 0x8744
+#ifndef GL_ATI_texture_float
+#define GL_RGBA_FLOAT32_ATI 0x8814
+#define GL_RGB_FLOAT32_ATI 0x8815
+#define GL_ALPHA_FLOAT32_ATI 0x8816
+#define GL_INTENSITY_FLOAT32_ATI 0x8817
+#define GL_LUMINANCE_FLOAT32_ATI 0x8818
+#define GL_RGBA_FLOAT16_ATI 0x881A
+#define GL_RGB_FLOAT16_ATI 0x881B
+#define GL_ALPHA_FLOAT16_ATI 0x881C
+#define GL_INTENSITY_FLOAT16_ATI 0x881D
+#define GL_LUMINANCE_FLOAT16_ATI 0x881E
+#ifndef GL_NV_float_buffer
+#define GL_FLOAT_R_NV 0x8880
+#define GL_FLOAT_RG_NV 0x8881
+#define GL_FLOAT_RGB_NV 0x8882
+#define GL_FLOAT_RGBA_NV 0x8883
+#define GL_FLOAT_R16_NV 0x8884
+#define GL_FLOAT_R32_NV 0x8885
+#define GL_FLOAT_RG16_NV 0x8886
+#define GL_FLOAT_RG32_NV 0x8887
+#define GL_FLOAT_RGB16_NV 0x8888
+#define GL_FLOAT_RGB32_NV 0x8889
+#define GL_FLOAT_RGBA16_NV 0x888A
+#define GL_FLOAT_RGBA32_NV 0x888B
+#define GL_FLOAT_RGBA_MODE_NV 0x888E
+#ifndef GL_NV_fragment_program
+#define GL_FRAGMENT_PROGRAM_NV 0x8870
+#define GL_MAX_TEXTURE_COORDS_NV 0x8871
+#ifndef GL_NV_half_float
+#define GL_HALF_FLOAT_NV 0x140B
+#ifndef GL_NV_pixel_data_range
+#ifndef GL_NV_primitive_restart
+#ifndef GL_NV_texture_expand_normal
+#ifndef GL_NV_vertex_program2
+#ifndef GL_ATI_map_object_buffer
+#ifndef GL_ATI_separate_stencil
+#define GL_STENCIL_BACK_FUNC_ATI 0x8800
+#define GL_STENCIL_BACK_FAIL_ATI 0x8801
+#ifndef GL_ATI_vertex_attrib_array_object
+#ifndef GL_OES_read_format
+#ifndef GL_EXT_depth_bounds_test
+#define GL_DEPTH_BOUNDS_TEST_EXT 0x8890
+#define GL_DEPTH_BOUNDS_EXT 0x8891
+#ifndef GL_EXT_texture_mirror_clamp
+#define GL_MIRROR_CLAMP_EXT 0x8742
+#ifndef GL_EXT_blend_equation_separate
+#ifndef GL_MESA_pack_invert
+#define GL_PACK_INVERT_MESA 0x8758
+#ifndef GL_MESA_ycbcr_texture
+#define GL_UNSIGNED_SHORT_8_8_MESA 0x85BA
+#define GL_YCBCR_MESA 0x8757
+#ifndef GL_EXT_pixel_buffer_object
+#ifndef GL_NV_fragment_program_option
+#ifndef GL_NV_fragment_program2
+#ifndef GL_NV_vertex_program2_option
+#ifndef GL_NV_vertex_program3
+#ifndef GL_EXT_framebuffer_object
+#define GL_FRAMEBUFFER_EXT 0x8D40
+#define GL_STENCIL_INDEX1_EXT 0x8D46
+#define GL_STENCIL_INDEX4_EXT 0x8D47
+#define GL_STENCIL_INDEX8_EXT 0x8D48
+#define GL_STENCIL_INDEX16_EXT 0x8D49
+#ifndef GL_GREMEDY_string_marker
+#include <stddef.h>
+#ifndef GL_VERSION_2_0
+/* GL type for program/shader text */
+typedef char GLchar; /* native character */
+#ifndef GL_VERSION_1_5
+/* GL types for handling large vertex buffer objects */
+typedef ptrdiff_t GLintptr;
+typedef ptrdiff_t GLsizeiptr;
+#ifndef GL_ARB_vertex_buffer_object
+/* GL types for handling large vertex buffer objects */
+typedef ptrdiff_t GLintptrARB;
+typedef ptrdiff_t GLsizeiptrARB;
+#ifndef GL_ARB_shader_objects
+/* GL types for handling shader object handles and program/shader text */
+typedef char GLcharARB; /* native character */
+typedef unsigned int GLhandleARB; /* shader object handle */
+/* GL types for "half" precision (s10e5) float data in host memory */
+#ifndef GL_ARB_half_float_pixel
+typedef unsigned short GLhalfARB;
+#ifndef GL_NV_half_float
+typedef unsigned short GLhalfNV;
+#ifndef GL_VERSION_1_2
+#define GL_VERSION_1_2 1
+GLAPI void APIENTRY glBlendColor (GLclampf, GLclampf, GLclampf, GLclampf);
+GLAPI void APIENTRY glBlendEquation (GLenum);
+GLAPI void APIENTRY glDrawRangeElements (GLenum, GLuint, GLuint, GLsizei, GLenum, const GLvoid *);
+GLAPI void APIENTRY glColorTable (GLenum, GLenum, GLsizei, GLenum, GLenum, const GLvoid *);
+GLAPI void APIENTRY glColorTableParameterfv (GLenum, GLenum, const GLfloat *);
+GLAPI void APIENTRY glColorTableParameteriv (GLenum, GLenum, const GLint *);
+GLAPI void APIENTRY glCopyColorTable (GLenum, GLenum, GLint, GLint, GLsizei);
+GLAPI void APIENTRY glGetColorTable (GLenum, GLenum, GLenum, GLvoid *);
+GLAPI void APIENTRY glGetColorTableParameterfv (GLenum, GLenum, GLfloat *);
+GLAPI void APIENTRY glGetColorTableParameteriv (GLenum, GLenum, GLint *);
+GLAPI void APIENTRY glColorSubTable (GLenum, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *);
+GLAPI void APIENTRY glCopyColorSubTable (GLenum, GLsizei, GLint, GLint, GLsizei);
+GLAPI void APIENTRY glConvolutionFilter1D (GLenum, GLenum, GLsizei, GLenum, GLenum, const GLvoid *);
+GLAPI void APIENTRY glConvolutionFilter2D (GLenum, GLenum, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *);
+GLAPI void APIENTRY glConvolutionParameterf (GLenum, GLenum, GLfloat);
+GLAPI void APIENTRY glConvolutionParameterfv (GLenum, GLenum, const GLfloat *);
+GLAPI void APIENTRY glConvolutionParameteri (GLenum, GLenum, GLint);
+GLAPI void APIENTRY glConvolutionParameteriv (GLenum, GLenum, const GLint *);
+GLAPI void APIENTRY glCopyConvolutionFilter1D (GLenum, GLenum, GLint, GLint, GLsizei);
+GLAPI void APIENTRY glCopyConvolutionFilter2D (GLenum, GLenum, GLint, GLint, GLsizei, GLsizei);
+GLAPI void APIENTRY glGetConvolutionFilter (GLenum, GLenum, GLenum, GLvoid *);
+GLAPI void APIENTRY glGetConvolutionParameterfv (GLenum, GLenum, GLfloat *);
+GLAPI void APIENTRY glGetConvolutionParameteriv (GLenum, GLenum, GLint *);
+GLAPI void APIENTRY glGetSeparableFilter (GLenum, GLenum, GLenum, GLvoid *, GLvoid *, GLvoid *);
+GLAPI void APIENTRY glSeparableFilter2D (GLenum, GLenum, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *, const GLvoid *);
+GLAPI void APIENTRY glGetHistogram (GLenum, GLboolean, GLenum, GLenum, GLvoid *);
+GLAPI void APIENTRY glGetHistogramParameterfv (GLenum, GLenum, GLfloat *);
+GLAPI void APIENTRY glGetHistogramParameteriv (GLenum, GLenum, GLint *);
+GLAPI void APIENTRY glGetMinmax (GLenum, GLboolean, GLenum, GLenum, GLvoid *);
+GLAPI void APIENTRY glGetMinmaxParameterfv (GLenum, GLenum, GLfloat *);
+GLAPI void APIENTRY glGetMinmaxParameteriv (GLenum, GLenum, GLint *);
+GLAPI void APIENTRY glHistogram (GLenum, GLsizei, GLenum, GLboolean);
+GLAPI void APIENTRY glMinmax (GLenum, GLenum, GLboolean);
+GLAPI void APIENTRY glResetHistogram (GLenum);
+GLAPI void APIENTRY glResetMinmax (GLenum);
+GLAPI void APIENTRY glTexImage3D (GLenum, GLint, GLint, GLsizei, GLsizei, GLsizei, GLint, GLenum, GLenum, const GLvoid *);
+GLAPI void APIENTRY glTexSubImage3D (GLenum, GLint, GLint, GLint, GLint, GLsizei, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *);
+GLAPI void APIENTRY glCopyTexSubImage3D (GLenum, GLint, GLint, GLint, GLint, GLint, GLint, GLsizei, GLsizei);
+typedef void (APIENTRYP PFNGLBLENDCOLORPROC) (GLclampf red, GLclampf green, GLclampf blue, GLclampf alpha);
+typedef void (APIENTRYP PFNGLDRAWRANGEELEMENTSPROC) (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, const GLvoid *indices);
+typedef void (APIENTRYP PFNGLCOLORTABLEPROC) (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const GLvoid *table);
+typedef void (APIENTRYP PFNGLCOLORTABLEPARAMETERFVPROC) (GLenum target, GLenum pname, const GLfloat *params);
+typedef void (APIENTRYP PFNGLCOLORTABLEPARAMETERIVPROC) (GLenum target, GLenum pname, const GLint *params);
+typedef void (APIENTRYP PFNGLCOPYCOLORTABLEPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width);
+typedef void (APIENTRYP PFNGLGETCOLORTABLEPROC) (GLenum target, GLenum format, GLenum type, GLvoid *table);
+typedef void (APIENTRYP PFNGLGETCOLORTABLEPARAMETERFVPROC) (GLenum target, GLenum pname, GLfloat *params);
+typedef void (APIENTRYP PFNGLGETCOLORTABLEPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params);
+typedef void (APIENTRYP PFNGLCOLORSUBTABLEPROC) (GLenum target, GLsizei start, GLsizei count, GLenum format, GLenum type, const GLvoid *data);
+typedef void (APIENTRYP PFNGLCOPYCOLORSUBTABLEPROC) (GLenum target, GLsizei start, GLint x, GLint y, GLsizei width);
+typedef void (APIENTRYP PFNGLCONVOLUTIONFILTER1DPROC) (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const GLvoid *image);
+typedef void (APIENTRYP PFNGLCONVOLUTIONFILTER2DPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *image);
+typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERFPROC) (GLenum target, GLenum pname, GLfloat params);
+typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERFVPROC) (GLenum target, GLenum pname, const GLfloat *params);
+typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERIPROC) (GLenum target, GLenum pname, GLint params);
+typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERIVPROC) (GLenum target, GLenum pname, const GLint *params);
+typedef void (APIENTRYP PFNGLCOPYCONVOLUTIONFILTER1DPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width);
+typedef void (APIENTRYP PFNGLCOPYCONVOLUTIONFILTER2DPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height);
+typedef void (APIENTRYP PFNGLGETCONVOLUTIONFILTERPROC) (GLenum target, GLenum format, GLenum type, GLvoid *image);
+typedef void (APIENTRYP PFNGLGETCONVOLUTIONPARAMETERFVPROC) (GLenum target, GLenum pname, GLfloat *params);
+typedef void (APIENTRYP PFNGLGETCONVOLUTIONPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params);
+typedef void (APIENTRYP PFNGLGETSEPARABLEFILTERPROC) (GLenum target, GLenum format, GLenum type, GLvoid *row, GLvoid *column, GLvoid *span);
+typedef void (APIENTRYP PFNGLSEPARABLEFILTER2DPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *row, const GLvoid *column);
+typedef void (APIENTRYP PFNGLGETHISTOGRAMPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, GLvoid *values);
+typedef void (APIENTRYP PFNGLGETHISTOGRAMPARAMETERFVPROC) (GLenum target, GLenum pname, GLfloat *params);
+typedef void (APIENTRYP PFNGLGETHISTOGRAMPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params);
+typedef void (APIENTRYP PFNGLGETMINMAXPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, GLvoid *values);
+typedef void (APIENTRYP PFNGLGETMINMAXPARAMETERFVPROC) (GLenum target, GLenum pname, GLfloat *params);
+typedef void (APIENTRYP PFNGLGETMINMAXPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params);
+typedef void (APIENTRYP PFNGLHISTOGRAMPROC) (GLenum target, GLsizei width, GLenum internalformat, GLboolean sink);
+typedef void (APIENTRYP PFNGLMINMAXPROC) (GLenum target, GLenum internalformat, GLboolean sink);
+typedef void (APIENTRYP PFNGLRESETMINMAXPROC) (GLenum target);
+typedef void (APIENTRYP PFNGLTEXIMAGE3DPROC) (GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const GLvoid *pixels);
+typedef void (APIENTRYP PFNGLTEXSUBIMAGE3DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const GLvoid *pixels);
+typedef void (APIENTRYP PFNGLCOPYTEXSUBIMAGE3DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint x, GLint y, GLsizei width, GLsizei height);
+#ifndef GL_VERSION_1_3
+#define GL_VERSION_1_3 1
+GLAPI void APIENTRY glActiveTexture (GLenum);
+GLAPI void APIENTRY glClientActiveTexture (GLenum);
+GLAPI void APIENTRY glMultiTexCoord1d (GLenum, GLdouble);
+GLAPI void APIENTRY glMultiTexCoord1dv (GLenum, const GLdouble *);
+GLAPI void APIENTRY glMultiTexCoord1f (GLenum, GLfloat);
+GLAPI void APIENTRY glMultiTexCoord1fv (GLenum, const GLfloat *);
+GLAPI void APIENTRY glMultiTexCoord1i (GLenum, GLint);
+GLAPI void APIENTRY glMultiTexCoord1iv (GLenum, const GLint *);
+GLAPI void APIENTRY glMultiTexCoord1s (GLenum, GLshort);
+GLAPI void APIENTRY glMultiTexCoord1sv (GLenum, const GLshort *);
+GLAPI void APIENTRY glMultiTexCoord2d (GLenum, GLdouble, GLdouble);
+GLAPI void APIENTRY glMultiTexCoord2dv (GLenum, const GLdouble *);
+GLAPI void APIENTRY glMultiTexCoord2f (GLenum, GLfloat, GLfloat);
+GLAPI void APIENTRY glMultiTexCoord2fv (GLenum, const GLfloat *);
+GLAPI void APIENTRY glMultiTexCoord2i (GLenum, GLint, GLint);
+GLAPI void APIENTRY glMultiTexCoord2iv (GLenum, const GLint *);
+GLAPI void APIENTRY glMultiTexCoord2s (GLenum, GLshort, GLshort);
+GLAPI void APIENTRY glMultiTexCoord2sv (GLenum, const GLshort *);
+GLAPI void APIENTRY glMultiTexCoord3d (GLenum, GLdouble, GLdouble, GLdouble);
+GLAPI void APIENTRY glMultiTexCoord3dv (GLenum, const GLdouble *);
+GLAPI void APIENTRY glMultiTexCoord3f (GLenum, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glMultiTexCoord3fv (GLenum, const GLfloat *);
+GLAPI void APIENTRY glMultiTexCoord3i (GLenum, GLint, GLint, GLint);
+GLAPI void APIENTRY glMultiTexCoord3iv (GLenum, const GLint *);
+GLAPI void APIENTRY glMultiTexCoord3s (GLenum, GLshort, GLshort, GLshort);
+GLAPI void APIENTRY glMultiTexCoord3sv (GLenum, const GLshort *);
+GLAPI void APIENTRY glMultiTexCoord4d (GLenum, GLdouble, GLdouble, GLdouble, GLdouble);
+GLAPI void APIENTRY glMultiTexCoord4dv (GLenum, const GLdouble *);
+GLAPI void APIENTRY glMultiTexCoord4f (GLenum, GLfloat, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glMultiTexCoord4fv (GLenum, const GLfloat *);
+GLAPI void APIENTRY glMultiTexCoord4i (GLenum, GLint, GLint, GLint, GLint);
+GLAPI void APIENTRY glMultiTexCoord4iv (GLenum, const GLint *);
+GLAPI void APIENTRY glMultiTexCoord4s (GLenum, GLshort, GLshort, GLshort, GLshort);
+GLAPI void APIENTRY glMultiTexCoord4sv (GLenum, const GLshort *);
+GLAPI void APIENTRY glLoadTransposeMatrixf (const GLfloat *);
+GLAPI void APIENTRY glLoadTransposeMatrixd (const GLdouble *);
+GLAPI void APIENTRY glMultTransposeMatrixf (const GLfloat *);
+GLAPI void APIENTRY glMultTransposeMatrixd (const GLdouble *);
+GLAPI void APIENTRY glSampleCoverage (GLclampf, GLboolean);
+GLAPI void APIENTRY glCompressedTexImage3D (GLenum, GLint, GLenum, GLsizei, GLsizei, GLsizei, GLint, GLsizei, const GLvoid *);
+GLAPI void APIENTRY glCompressedTexImage2D (GLenum, GLint, GLenum, GLsizei, GLsizei, GLint, GLsizei, const GLvoid *);
+GLAPI void APIENTRY glCompressedTexImage1D (GLenum, GLint, GLenum, GLsizei, GLint, GLsizei, const GLvoid *);
+GLAPI void APIENTRY glCompressedTexSubImage3D (GLenum, GLint, GLint, GLint, GLint, GLsizei, GLsizei, GLsizei, GLenum, GLsizei, const GLvoid *);
+GLAPI void APIENTRY glCompressedTexSubImage2D (GLenum, GLint, GLint, GLint, GLsizei, GLsizei, GLenum, GLsizei, const GLvoid *);
+GLAPI void APIENTRY glCompressedTexSubImage1D (GLenum, GLint, GLint, GLsizei, GLenum, GLsizei, const GLvoid *);
+GLAPI void APIENTRY glGetCompressedTexImage (GLenum, GLint, GLvoid *);
+typedef void (APIENTRYP PFNGLACTIVETEXTUREPROC) (GLenum texture);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD1DPROC) (GLenum target, GLdouble s);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD1DVPROC) (GLenum target, const GLdouble *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD1FPROC) (GLenum target, GLfloat s);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD1FVPROC) (GLenum target, const GLfloat *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD1IPROC) (GLenum target, GLint s);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD1IVPROC) (GLenum target, const GLint *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD1SPROC) (GLenum target, GLshort s);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD1SVPROC) (GLenum target, const GLshort *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD2DPROC) (GLenum target, GLdouble s, GLdouble t);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD2DVPROC) (GLenum target, const GLdouble *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD2FPROC) (GLenum target, GLfloat s, GLfloat t);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD2FVPROC) (GLenum target, const GLfloat *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD2IPROC) (GLenum target, GLint s, GLint t);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD2IVPROC) (GLenum target, const GLint *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD2SPROC) (GLenum target, GLshort s, GLshort t);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD2SVPROC) (GLenum target, const GLshort *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD3DPROC) (GLenum target, GLdouble s, GLdouble t, GLdouble r);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD3DVPROC) (GLenum target, const GLdouble *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD3FPROC) (GLenum target, GLfloat s, GLfloat t, GLfloat r);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD3FVPROC) (GLenum target, const GLfloat *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD3IPROC) (GLenum target, GLint s, GLint t, GLint r);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD3IVPROC) (GLenum target, const GLint *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD3SPROC) (GLenum target, GLshort s, GLshort t, GLshort r);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD3SVPROC) (GLenum target, const GLshort *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD4DPROC) (GLenum target, GLdouble s, GLdouble t, GLdouble r, GLdouble q);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD4DVPROC) (GLenum target, const GLdouble *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD4FPROC) (GLenum target, GLfloat s, GLfloat t, GLfloat r, GLfloat q);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD4FVPROC) (GLenum target, const GLfloat *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD4IPROC) (GLenum target, GLint s, GLint t, GLint r, GLint q);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD4IVPROC) (GLenum target, const GLint *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD4SPROC) (GLenum target, GLshort s, GLshort t, GLshort r, GLshort q);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD4SVPROC) (GLenum target, const GLshort *v);
+typedef void (APIENTRYP PFNGLSAMPLECOVERAGEPROC) (GLclampf value, GLboolean invert);
+typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE3DPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const GLvoid *data);
+typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE2DPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const GLvoid *data);
+typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE1DPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const GLvoid *data);
+typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE3DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const GLvoid *data);
+typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE2DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const GLvoid *data);
+typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE1DPROC) (GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const GLvoid *data);
+typedef void (APIENTRYP PFNGLGETCOMPRESSEDTEXIMAGEPROC) (GLenum target, GLint level, GLvoid *img);
+#ifndef GL_VERSION_1_4
+#define GL_VERSION_1_4 1
+GLAPI void APIENTRY glBlendFuncSeparate (GLenum, GLenum, GLenum, GLenum);
+GLAPI void APIENTRY glFogCoordf (GLfloat);
+GLAPI void APIENTRY glFogCoordfv (const GLfloat *);
+GLAPI void APIENTRY glFogCoordd (GLdouble);
+GLAPI void APIENTRY glFogCoorddv (const GLdouble *);
+GLAPI void APIENTRY glFogCoordPointer (GLenum, GLsizei, const GLvoid *);
+GLAPI void APIENTRY glMultiDrawArrays (GLenum, GLint *, GLsizei *, GLsizei);
+GLAPI void APIENTRY glMultiDrawElements (GLenum, const GLsizei *, GLenum, const GLvoid* *, GLsizei);
+GLAPI void APIENTRY glPointParameterf (GLenum, GLfloat);
+GLAPI void APIENTRY glPointParameterfv (GLenum, const GLfloat *);
+GLAPI void APIENTRY glPointParameteri (GLenum, GLint);
+GLAPI void APIENTRY glPointParameteriv (GLenum, const GLint *);
+GLAPI void APIENTRY glSecondaryColor3b (GLbyte, GLbyte, GLbyte);
+GLAPI void APIENTRY glSecondaryColor3bv (const GLbyte *);
+GLAPI void APIENTRY glSecondaryColor3d (GLdouble, GLdouble, GLdouble);
+GLAPI void APIENTRY glSecondaryColor3dv (const GLdouble *);
+GLAPI void APIENTRY glSecondaryColor3f (GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glSecondaryColor3fv (const GLfloat *);
+GLAPI void APIENTRY glSecondaryColor3i (GLint, GLint, GLint);
+GLAPI void APIENTRY glSecondaryColor3iv (const GLint *);
+GLAPI void APIENTRY glSecondaryColor3s (GLshort, GLshort, GLshort);
+GLAPI void APIENTRY glSecondaryColor3sv (const GLshort *);
+GLAPI void APIENTRY glSecondaryColor3ub (GLubyte, GLubyte, GLubyte);
+GLAPI void APIENTRY glSecondaryColor3ubv (const GLubyte *);
+GLAPI void APIENTRY glSecondaryColor3ui (GLuint, GLuint, GLuint);
+GLAPI void APIENTRY glSecondaryColor3uiv (const GLuint *);
+GLAPI void APIENTRY glSecondaryColor3us (GLushort, GLushort, GLushort);
+GLAPI void APIENTRY glSecondaryColor3usv (const GLushort *);
+GLAPI void APIENTRY glSecondaryColorPointer (GLint, GLenum, GLsizei, const GLvoid *);
+GLAPI void APIENTRY glWindowPos2d (GLdouble, GLdouble);
+GLAPI void APIENTRY glWindowPos2dv (const GLdouble *);
+GLAPI void APIENTRY glWindowPos2f (GLfloat, GLfloat);
+GLAPI void APIENTRY glWindowPos2fv (const GLfloat *);
+GLAPI void APIENTRY glWindowPos2i (GLint, GLint);
+GLAPI void APIENTRY glWindowPos2iv (const GLint *);
+GLAPI void APIENTRY glWindowPos2s (GLshort, GLshort);
+GLAPI void APIENTRY glWindowPos2sv (const GLshort *);
+GLAPI void APIENTRY glWindowPos3d (GLdouble, GLdouble, GLdouble);
+GLAPI void APIENTRY glWindowPos3dv (const GLdouble *);
+GLAPI void APIENTRY glWindowPos3f (GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glWindowPos3fv (const GLfloat *);
+GLAPI void APIENTRY glWindowPos3i (GLint, GLint, GLint);
+GLAPI void APIENTRY glWindowPos3iv (const GLint *);
+GLAPI void APIENTRY glWindowPos3s (GLshort, GLshort, GLshort);
+GLAPI void APIENTRY glWindowPos3sv (const GLshort *);
+typedef void (APIENTRYP PFNGLBLENDFUNCSEPARATEPROC) (GLenum sfactorRGB, GLenum dfactorRGB, GLenum sfactorAlpha, GLenum dfactorAlpha);
+typedef void (APIENTRYP PFNGLFOGCOORDFPROC) (GLfloat coord);
+typedef void (APIENTRYP PFNGLFOGCOORDFVPROC) (const GLfloat *coord);
+typedef void (APIENTRYP PFNGLFOGCOORDDPROC) (GLdouble coord);
+typedef void (APIENTRYP PFNGLFOGCOORDDVPROC) (const GLdouble *coord);
+typedef void (APIENTRYP PFNGLFOGCOORDPOINTERPROC) (GLenum type, GLsizei stride, const GLvoid *pointer);
+typedef void (APIENTRYP PFNGLMULTIDRAWARRAYSPROC) (GLenum mode, GLint *first, GLsizei *count, GLsizei primcount);
+typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTSPROC) (GLenum mode, const GLsizei *count, GLenum type, const GLvoid* *indices, GLsizei primcount);
+typedef void (APIENTRYP PFNGLPOINTPARAMETERFPROC) (GLenum pname, GLfloat param);
+typedef void (APIENTRYP PFNGLPOINTPARAMETERFVPROC) (GLenum pname, const GLfloat *params);
+typedef void (APIENTRYP PFNGLPOINTPARAMETERIPROC) (GLenum pname, GLint param);
+typedef void (APIENTRYP PFNGLPOINTPARAMETERIVPROC) (GLenum pname, const GLint *params);
+typedef void (APIENTRYP PFNGLSECONDARYCOLOR3BPROC) (GLbyte red, GLbyte green, GLbyte blue);
+typedef void (APIENTRYP PFNGLSECONDARYCOLOR3DPROC) (GLdouble red, GLdouble green, GLdouble blue);
+typedef void (APIENTRYP PFNGLSECONDARYCOLOR3DVPROC) (const GLdouble *v);
+typedef void (APIENTRYP PFNGLSECONDARYCOLOR3FPROC) (GLfloat red, GLfloat green, GLfloat blue);
+typedef void (APIENTRYP PFNGLSECONDARYCOLOR3FVPROC) (const GLfloat *v);
+typedef void (APIENTRYP PFNGLSECONDARYCOLOR3IPROC) (GLint red, GLint green, GLint blue);
+typedef void (APIENTRYP PFNGLSECONDARYCOLOR3SPROC) (GLshort red, GLshort green, GLshort blue);
+typedef void (APIENTRYP PFNGLSECONDARYCOLOR3SVPROC) (const GLshort *v);
+typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UBPROC) (GLubyte red, GLubyte green, GLubyte blue);
+typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UIPROC) (GLuint red, GLuint green, GLuint blue);
+typedef void (APIENTRYP PFNGLSECONDARYCOLOR3USPROC) (GLushort red, GLushort green, GLushort blue);
+typedef void (APIENTRYP PFNGLSECONDARYCOLOR3USVPROC) (const GLushort *v);
+typedef void (APIENTRYP PFNGLSECONDARYCOLORPOINTERPROC) (GLint size, GLenum type, GLsizei stride, const GLvoid *pointer);
+typedef void (APIENTRYP PFNGLWINDOWPOS2DPROC) (GLdouble x, GLdouble y);
+typedef void (APIENTRYP PFNGLWINDOWPOS2DVPROC) (const GLdouble *v);
+typedef void (APIENTRYP PFNGLWINDOWPOS2FPROC) (GLfloat x, GLfloat y);
+typedef void (APIENTRYP PFNGLWINDOWPOS2FVPROC) (const GLfloat *v);
+typedef void (APIENTRYP PFNGLWINDOWPOS2IPROC) (GLint x, GLint y);
+typedef void (APIENTRYP PFNGLWINDOWPOS2IVPROC) (const GLint *v);
+typedef void (APIENTRYP PFNGLWINDOWPOS2SPROC) (GLshort x, GLshort y);
+typedef void (APIENTRYP PFNGLWINDOWPOS2SVPROC) (const GLshort *v);
+typedef void (APIENTRYP PFNGLWINDOWPOS3DPROC) (GLdouble x, GLdouble y, GLdouble z);
+typedef void (APIENTRYP PFNGLWINDOWPOS3DVPROC) (const GLdouble *v);
+typedef void (APIENTRYP PFNGLWINDOWPOS3FPROC) (GLfloat x, GLfloat y, GLfloat z);
+typedef void (APIENTRYP PFNGLWINDOWPOS3FVPROC) (const GLfloat *v);
+typedef void (APIENTRYP PFNGLWINDOWPOS3IPROC) (GLint x, GLint y, GLint z);
+typedef void (APIENTRYP PFNGLWINDOWPOS3IVPROC) (const GLint *v);
+typedef void (APIENTRYP PFNGLWINDOWPOS3SPROC) (GLshort x, GLshort y, GLshort z);
+typedef void (APIENTRYP PFNGLWINDOWPOS3SVPROC) (const GLshort *v);
+#ifndef GL_VERSION_1_5
+#define GL_VERSION_1_5 1
+GLAPI void APIENTRY glGenQueries (GLsizei, GLuint *);
+GLAPI void APIENTRY glDeleteQueries (GLsizei, const GLuint *);
+GLAPI GLboolean APIENTRY glIsQuery (GLuint);
+GLAPI void APIENTRY glBeginQuery (GLenum, GLuint);
+GLAPI void APIENTRY glEndQuery (GLenum);
+GLAPI void APIENTRY glGetQueryiv (GLenum, GLenum, GLint *);
+GLAPI void APIENTRY glGetQueryObjectiv (GLuint, GLenum, GLint *);
+GLAPI void APIENTRY glGetQueryObjectuiv (GLuint, GLenum, GLuint *);
+GLAPI void APIENTRY glBindBuffer (GLenum, GLuint);
+GLAPI void APIENTRY glDeleteBuffers (GLsizei, const GLuint *);
+GLAPI void APIENTRY glGenBuffers (GLsizei, GLuint *);
+GLAPI GLboolean APIENTRY glIsBuffer (GLuint);
+GLAPI void APIENTRY glBufferData (GLenum, GLsizeiptr, const GLvoid *, GLenum);
+GLAPI void APIENTRY glBufferSubData (GLenum, GLintptr, GLsizeiptr, const GLvoid *);
+GLAPI void APIENTRY glGetBufferSubData (GLenum, GLintptr, GLsizeiptr, GLvoid *);
+GLAPI GLvoid* APIENTRY glMapBuffer (GLenum, GLenum);
+GLAPI GLboolean APIENTRY glUnmapBuffer (GLenum);
+GLAPI void APIENTRY glGetBufferParameteriv (GLenum, GLenum, GLint *);
+GLAPI void APIENTRY glGetBufferPointerv (GLenum, GLenum, GLvoid* *);
+typedef void (APIENTRYP PFNGLGENQUERIESPROC) (GLsizei n, GLuint *ids);
+typedef void (APIENTRYP PFNGLDELETEQUERIESPROC) (GLsizei n, const GLuint *ids);
+typedef GLboolean (APIENTRYP PFNGLISQUERYPROC) (GLuint id);
+typedef void (APIENTRYP PFNGLBEGINQUERYPROC) (GLenum target, GLuint id);
+typedef void (APIENTRYP PFNGLENDQUERYPROC) (GLenum target);
+typedef void (APIENTRYP PFNGLGETQUERYIVPROC) (GLenum target, GLenum pname, GLint *params);
+typedef void (APIENTRYP PFNGLGETQUERYOBJECTIVPROC) (GLuint id, GLenum pname, GLint *params);
+typedef void (APIENTRYP PFNGLGETQUERYOBJECTUIVPROC) (GLuint id, GLenum pname, GLuint *params);
+typedef void (APIENTRYP PFNGLBINDBUFFERPROC) (GLenum target, GLuint buffer);
+typedef void (APIENTRYP PFNGLDELETEBUFFERSPROC) (GLsizei n, const GLuint *buffers);
+typedef void (APIENTRYP PFNGLGENBUFFERSPROC) (GLsizei n, GLuint *buffers);
+typedef GLboolean (APIENTRYP PFNGLISBUFFERPROC) (GLuint buffer);
+typedef void (APIENTRYP PFNGLBUFFERDATAPROC) (GLenum target, GLsizeiptr size, const GLvoid *data, GLenum usage);
+typedef void (APIENTRYP PFNGLBUFFERSUBDATAPROC) (GLenum target, GLintptr offset, GLsizeiptr size, const GLvoid *data);
+typedef void (APIENTRYP PFNGLGETBUFFERSUBDATAPROC) (GLenum target, GLintptr offset, GLsizeiptr size, GLvoid *data);
+typedef GLvoid* (APIENTRYP PFNGLMAPBUFFERPROC) (GLenum target, GLenum access);
+typedef GLboolean (APIENTRYP PFNGLUNMAPBUFFERPROC) (GLenum target);
+typedef void (APIENTRYP PFNGLGETBUFFERPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params);
+typedef void (APIENTRYP PFNGLGETBUFFERPOINTERVPROC) (GLenum target, GLenum pname, GLvoid* *params);
+#ifndef GL_VERSION_2_0
+#define GL_VERSION_2_0 1
+GLAPI void APIENTRY glBlendEquationSeparate (GLenum, GLenum);
+GLAPI void APIENTRY glDrawBuffers (GLsizei, const GLenum *);
+GLAPI void APIENTRY glStencilOpSeparate (GLenum, GLenum, GLenum, GLenum);
+GLAPI void APIENTRY glStencilFuncSeparate (GLenum, GLenum, GLint, GLuint);
+GLAPI void APIENTRY glStencilMaskSeparate (GLenum, GLuint);
+GLAPI void APIENTRY glAttachShader (GLuint, GLuint);
+GLAPI void APIENTRY glBindAttribLocation (GLuint, GLuint, const GLchar *);
+GLAPI void APIENTRY glCompileShader (GLuint);
+GLAPI GLuint APIENTRY glCreateProgram (void);
+GLAPI GLuint APIENTRY glCreateShader (GLenum);
+GLAPI void APIENTRY glDeleteProgram (GLuint);
+GLAPI void APIENTRY glDeleteShader (GLuint);
+GLAPI void APIENTRY glDetachShader (GLuint, GLuint);
+GLAPI void APIENTRY glDisableVertexAttribArray (GLuint);
+GLAPI void APIENTRY glEnableVertexAttribArray (GLuint);
+GLAPI void APIENTRY glGetActiveAttrib (GLuint, GLuint, GLsizei, GLsizei *, GLint *, GLenum *, GLchar *);
+GLAPI void APIENTRY glGetActiveUniform (GLuint, GLuint, GLsizei, GLsizei *, GLint *, GLenum *, GLchar *);
+GLAPI void APIENTRY glGetAttachedShaders (GLuint, GLsizei, GLsizei *, GLuint *);
+GLAPI GLint APIENTRY glGetAttribLocation (GLuint, const GLchar *);
+GLAPI void APIENTRY glGetProgramiv (GLuint, GLenum, GLint *);
+GLAPI void APIENTRY glGetProgramInfoLog (GLuint, GLsizei, GLsizei *, GLchar *);
+GLAPI void APIENTRY glGetShaderiv (GLuint, GLenum, GLint *);
+GLAPI void APIENTRY glGetShaderInfoLog (GLuint, GLsizei, GLsizei *, GLchar *);
+GLAPI void APIENTRY glGetShaderSource (GLuint, GLsizei, GLsizei *, GLchar *);
+GLAPI GLint APIENTRY glGetUniformLocation (GLuint, const GLchar *);
+GLAPI void APIENTRY glGetUniformfv (GLuint, GLint, GLfloat *);
+GLAPI void APIENTRY glGetUniformiv (GLuint, GLint, GLint *);
+GLAPI void APIENTRY glGetVertexAttribdv (GLuint, GLenum, GLdouble *);
+GLAPI void APIENTRY glGetVertexAttribfv (GLuint, GLenum, GLfloat *);
+GLAPI void APIENTRY glGetVertexAttribiv (GLuint, GLenum, GLint *);
+GLAPI void APIENTRY glGetVertexAttribPointerv (GLuint, GLenum, GLvoid* *);
+GLAPI GLboolean APIENTRY glIsProgram (GLuint);
+GLAPI GLboolean APIENTRY glIsShader (GLuint);
+GLAPI void APIENTRY glLinkProgram (GLuint);
+GLAPI void APIENTRY glShaderSource (GLuint, GLsizei, const GLchar* *, const GLint *);
+GLAPI void APIENTRY glUseProgram (GLuint);
+GLAPI void APIENTRY glUniform1f (GLint, GLfloat);
+GLAPI void APIENTRY glUniform2f (GLint, GLfloat, GLfloat);
+GLAPI void APIENTRY glUniform3f (GLint, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glUniform4f (GLint, GLfloat, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glUniform1i (GLint, GLint);
+GLAPI void APIENTRY glUniform2i (GLint, GLint, GLint);
+GLAPI void APIENTRY glUniform3i (GLint, GLint, GLint, GLint);
+GLAPI void APIENTRY glUniform4i (GLint, GLint, GLint, GLint, GLint);
+GLAPI void APIENTRY glUniform1fv (GLint, GLsizei, const GLfloat *);
+GLAPI void APIENTRY glUniform2fv (GLint, GLsizei, const GLfloat *);
+GLAPI void APIENTRY glUniform3fv (GLint, GLsizei, const GLfloat *);
+GLAPI void APIENTRY glUniform4fv (GLint, GLsizei, const GLfloat *);
+GLAPI void APIENTRY glUniform1iv (GLint, GLsizei, const GLint *);
+GLAPI void APIENTRY glUniform2iv (GLint, GLsizei, const GLint *);
+GLAPI void APIENTRY glUniform3iv (GLint, GLsizei, const GLint *);
+GLAPI void APIENTRY glUniform4iv (GLint, GLsizei, const GLint *);
+GLAPI void APIENTRY glUniformMatrix2fv (GLint, GLsizei, GLboolean, const GLfloat *);
+GLAPI void APIENTRY glUniformMatrix3fv (GLint, GLsizei, GLboolean, const GLfloat *);
+GLAPI void APIENTRY glUniformMatrix4fv (GLint, GLsizei, GLboolean, const GLfloat *);
+GLAPI void APIENTRY glValidateProgram (GLuint);
+GLAPI void APIENTRY glVertexAttrib1d (GLuint, GLdouble);
+GLAPI void APIENTRY glVertexAttrib1dv (GLuint, const GLdouble *);
+GLAPI void APIENTRY glVertexAttrib1f (GLuint, GLfloat);
+GLAPI void APIENTRY glVertexAttrib1fv (GLuint, const GLfloat *);
+GLAPI void APIENTRY glVertexAttrib1s (GLuint, GLshort);
+GLAPI void APIENTRY glVertexAttrib1sv (GLuint, const GLshort *);
+GLAPI void APIENTRY glVertexAttrib2d (GLuint, GLdouble, GLdouble);
+GLAPI void APIENTRY glVertexAttrib2dv (GLuint, const GLdouble *);
+GLAPI void APIENTRY glVertexAttrib2f (GLuint, GLfloat, GLfloat);
+GLAPI void APIENTRY glVertexAttrib2fv (GLuint, const GLfloat *);
+GLAPI void APIENTRY glVertexAttrib2s (GLuint, GLshort, GLshort);
+GLAPI void APIENTRY glVertexAttrib2sv (GLuint, const GLshort *);
+GLAPI void APIENTRY glVertexAttrib3d (GLuint, GLdouble, GLdouble, GLdouble);
+GLAPI void APIENTRY glVertexAttrib3dv (GLuint, const GLdouble *);
+GLAPI void APIENTRY glVertexAttrib3f (GLuint, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glVertexAttrib3fv (GLuint, const GLfloat *);
+GLAPI void APIENTRY glVertexAttrib3s (GLuint, GLshort, GLshort, GLshort);
+GLAPI void APIENTRY glVertexAttrib3sv (GLuint, const GLshort *);
+GLAPI void APIENTRY glVertexAttrib4Nbv (GLuint, const GLbyte *);
+GLAPI void APIENTRY glVertexAttrib4Niv (GLuint, const GLint *);
+GLAPI void APIENTRY glVertexAttrib4Nsv (GLuint, const GLshort *);
+GLAPI void APIENTRY glVertexAttrib4Nub (GLuint, GLubyte, GLubyte, GLubyte, GLubyte);
+GLAPI void APIENTRY glVertexAttrib4Nubv (GLuint, const GLubyte *);
+GLAPI void APIENTRY glVertexAttrib4Nuiv (GLuint, const GLuint *);
+GLAPI void APIENTRY glVertexAttrib4Nusv (GLuint, const GLushort *);
+GLAPI void APIENTRY glVertexAttrib4bv (GLuint, const GLbyte *);
+GLAPI void APIENTRY glVertexAttrib4d (GLuint, GLdouble, GLdouble, GLdouble, GLdouble);
+GLAPI void APIENTRY glVertexAttrib4dv (GLuint, const GLdouble *);
+GLAPI void APIENTRY glVertexAttrib4f (GLuint, GLfloat, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glVertexAttrib4fv (GLuint, const GLfloat *);
+GLAPI void APIENTRY glVertexAttrib4iv (GLuint, const GLint *);
+GLAPI void APIENTRY glVertexAttrib4s (GLuint, GLshort, GLshort, GLshort, GLshort);
+GLAPI void APIENTRY glVertexAttrib4sv (GLuint, const GLshort *);
+GLAPI void APIENTRY glVertexAttrib4ubv (GLuint, const GLubyte *);
+GLAPI void APIENTRY glVertexAttrib4uiv (GLuint, const GLuint *);
+GLAPI void APIENTRY glVertexAttrib4usv (GLuint, const GLushort *);
+GLAPI void APIENTRY glVertexAttribPointer (GLuint, GLint, GLenum, GLboolean, GLsizei, const GLvoid *);
+typedef void (APIENTRYP PFNGLDRAWBUFFERSPROC) (GLsizei n, const GLenum *bufs);
+typedef void (APIENTRYP PFNGLSTENCILOPSEPARATEPROC) (GLenum face, GLenum sfail, GLenum dpfail, GLenum dppass);
+typedef void (APIENTRYP PFNGLSTENCILFUNCSEPARATEPROC) (GLenum frontfunc, GLenum backfunc, GLint ref, GLuint mask);
+typedef void (APIENTRYP PFNGLSTENCILMASKSEPARATEPROC) (GLenum face, GLuint mask);
+typedef void (APIENTRYP PFNGLATTACHSHADERPROC) (GLuint program, GLuint shader);
+typedef void (APIENTRYP PFNGLBINDATTRIBLOCATIONPROC) (GLuint program, GLuint index, const GLchar *name);
+typedef void (APIENTRYP PFNGLDELETEPROGRAMPROC) (GLuint program);
+typedef void (APIENTRYP PFNGLDELETESHADERPROC) (GLuint shader);
+typedef void (APIENTRYP PFNGLDETACHSHADERPROC) (GLuint program, GLuint shader);
+typedef void (APIENTRYP PFNGLGETACTIVEATTRIBPROC) (GLuint program, GLuint index, GLsizei bufSize, GLsizei *length, GLint *size, GLenum *type, GLchar *name);
+typedef void (APIENTRYP PFNGLGETACTIVEUNIFORMPROC) (GLuint program, GLuint index, GLsizei bufSize, GLsizei *length, GLint *size, GLenum *type, GLchar *name);
+typedef void (APIENTRYP PFNGLGETATTACHEDSHADERSPROC) (GLuint program, GLsizei maxCount, GLsizei *count, GLuint *obj);
+typedef GLint (APIENTRYP PFNGLGETATTRIBLOCATIONPROC) (GLuint program, const GLchar *name);
+typedef void (APIENTRYP PFNGLGETPROGRAMIVPROC) (GLuint program, GLenum pname, GLint *params);
+typedef void (APIENTRYP PFNGLGETPROGRAMINFOLOGPROC) (GLuint program, GLsizei bufSize, GLsizei *length, GLchar *infoLog);
+typedef void (APIENTRYP PFNGLGETSHADERIVPROC) (GLuint shader, GLenum pname, GLint *params);
+typedef void (APIENTRYP PFNGLGETSHADERINFOLOGPROC) (GLuint shader, GLsizei bufSize, GLsizei *length, GLchar *infoLog);
+typedef void (APIENTRYP PFNGLGETSHADERSOURCEPROC) (GLuint shader, GLsizei bufSize, GLsizei *length, GLchar *source);
+typedef GLint (APIENTRYP PFNGLGETUNIFORMLOCATIONPROC) (GLuint program, const GLchar *name);
+typedef void (APIENTRYP PFNGLGETUNIFORMFVPROC) (GLuint program, GLint location, GLfloat *params);
+typedef void (APIENTRYP PFNGLGETUNIFORMIVPROC) (GLuint program, GLint location, GLint *params);
+typedef void (APIENTRYP PFNGLGETVERTEXATTRIBDVPROC) (GLuint index, GLenum pname, GLdouble *params);
+typedef void (APIENTRYP PFNGLGETVERTEXATTRIBFVPROC) (GLuint index, GLenum pname, GLfloat *params);
+typedef void (APIENTRYP PFNGLGETVERTEXATTRIBIVPROC) (GLuint index, GLenum pname, GLint *params);
+typedef void (APIENTRYP PFNGLGETVERTEXATTRIBPOINTERVPROC) (GLuint index, GLenum pname, GLvoid* *pointer);
+typedef GLboolean (APIENTRYP PFNGLISPROGRAMPROC) (GLuint program);
+typedef GLboolean (APIENTRYP PFNGLISSHADERPROC) (GLuint shader);
+typedef void (APIENTRYP PFNGLLINKPROGRAMPROC) (GLuint program);
+typedef void (APIENTRYP PFNGLSHADERSOURCEPROC) (GLuint shader, GLsizei count, const GLchar* *string, const GLint *length);
+typedef void (APIENTRYP PFNGLUSEPROGRAMPROC) (GLuint program);
+typedef void (APIENTRYP PFNGLUNIFORM1FPROC) (GLint location, GLfloat v0);
+typedef void (APIENTRYP PFNGLUNIFORM2FPROC) (GLint location, GLfloat v0, GLfloat v1);
+typedef void (APIENTRYP PFNGLUNIFORM3FPROC) (GLint location, GLfloat v0, GLfloat v1, GLfloat v2);
+typedef void (APIENTRYP PFNGLUNIFORM4FPROC) (GLint location, GLfloat v0, GLfloat v1, GLfloat v2, GLfloat v3);
+typedef void (APIENTRYP PFNGLUNIFORM1IPROC) (GLint location, GLint v0);
+typedef void (APIENTRYP PFNGLUNIFORM2IPROC) (GLint location, GLint v0, GLint v1);
+typedef void (APIENTRYP PFNGLUNIFORM3IPROC) (GLint location, GLint v0, GLint v1, GLint v2);
+typedef void (APIENTRYP PFNGLUNIFORM4IPROC) (GLint location, GLint v0, GLint v1, GLint v2, GLint v3);
+typedef void (APIENTRYP PFNGLUNIFORM1FVPROC) (GLint location, GLsizei count, const GLfloat *value);
+typedef void (APIENTRYP PFNGLUNIFORM2FVPROC) (GLint location, GLsizei count, const GLfloat *value);
+typedef void (APIENTRYP PFNGLUNIFORM3FVPROC) (GLint location, GLsizei count, const GLfloat *value);
+typedef void (APIENTRYP PFNGLUNIFORM4FVPROC) (GLint location, GLsizei count, const GLfloat *value);
+typedef void (APIENTRYP PFNGLUNIFORM1IVPROC) (GLint location, GLsizei count, const GLint *value);
+typedef void (APIENTRYP PFNGLUNIFORM2IVPROC) (GLint location, GLsizei count, const GLint *value);
+typedef void (APIENTRYP PFNGLUNIFORM3IVPROC) (GLint location, GLsizei count, const GLint *value);
+typedef void (APIENTRYP PFNGLUNIFORM4IVPROC) (GLint location, GLsizei count, const GLint *value);
+typedef void (APIENTRYP PFNGLUNIFORMMATRIX2FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value);
+typedef void (APIENTRYP PFNGLUNIFORMMATRIX3FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value);
+typedef void (APIENTRYP PFNGLUNIFORMMATRIX4FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB1DPROC) (GLuint index, GLdouble x);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB1DVPROC) (GLuint index, const GLdouble *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB1FPROC) (GLuint index, GLfloat x);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB1FVPROC) (GLuint index, const GLfloat *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB1SPROC) (GLuint index, GLshort x);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB1SVPROC) (GLuint index, const GLshort *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB2DPROC) (GLuint index, GLdouble x, GLdouble y);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB2DVPROC) (GLuint index, const GLdouble *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB2FPROC) (GLuint index, GLfloat x, GLfloat y);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB2FVPROC) (GLuint index, const GLfloat *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB2SPROC) (GLuint index, GLshort x, GLshort y);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB2SVPROC) (GLuint index, const GLshort *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB3DPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB3DVPROC) (GLuint index, const GLdouble *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB3FPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat z);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB3FVPROC) (GLuint index, const GLfloat *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB3SPROC) (GLuint index, GLshort x, GLshort y, GLshort z);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB3SVPROC) (GLuint index, const GLshort *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4NBVPROC) (GLuint index, const GLbyte *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4NIVPROC) (GLuint index, const GLint *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4NSVPROC) (GLuint index, const GLshort *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUBPROC) (GLuint index, GLubyte x, GLubyte y, GLubyte z, GLubyte w);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUBVPROC) (GLuint index, const GLubyte *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUIVPROC) (GLuint index, const GLuint *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUSVPROC) (GLuint index, const GLushort *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4BVPROC) (GLuint index, const GLbyte *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4DPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4DVPROC) (GLuint index, const GLdouble *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4FPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4FVPROC) (GLuint index, const GLfloat *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4IVPROC) (GLuint index, const GLint *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4SPROC) (GLuint index, GLshort x, GLshort y, GLshort z, GLshort w);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4SVPROC) (GLuint index, const GLshort *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4UBVPROC) (GLuint index, const GLubyte *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4UIVPROC) (GLuint index, const GLuint *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4USVPROC) (GLuint index, const GLushort *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIBPOINTERPROC) (GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride, const GLvoid *pointer);
+#ifndef GL_ARB_multitexture
+#define GL_ARB_multitexture 1
+GLAPI void APIENTRY glActiveTextureARB (GLenum);
+GLAPI void APIENTRY glClientActiveTextureARB (GLenum);
+GLAPI void APIENTRY glMultiTexCoord1dARB (GLenum, GLdouble);
+GLAPI void APIENTRY glMultiTexCoord1dvARB (GLenum, const GLdouble *);
+GLAPI void APIENTRY glMultiTexCoord1fARB (GLenum, GLfloat);
+GLAPI void APIENTRY glMultiTexCoord1fvARB (GLenum, const GLfloat *);
+GLAPI void APIENTRY glMultiTexCoord1iARB (GLenum, GLint);
+GLAPI void APIENTRY glMultiTexCoord1ivARB (GLenum, const GLint *);
+GLAPI void APIENTRY glMultiTexCoord1sARB (GLenum, GLshort);
+GLAPI void APIENTRY glMultiTexCoord1svARB (GLenum, const GLshort *);
+GLAPI void APIENTRY glMultiTexCoord2dARB (GLenum, GLdouble, GLdouble);
+GLAPI void APIENTRY glMultiTexCoord2dvARB (GLenum, const GLdouble *);
+GLAPI void APIENTRY glMultiTexCoord2fARB (GLenum, GLfloat, GLfloat);
+GLAPI void APIENTRY glMultiTexCoord2fvARB (GLenum, const GLfloat *);
+GLAPI void APIENTRY glMultiTexCoord2iARB (GLenum, GLint, GLint);
+GLAPI void APIENTRY glMultiTexCoord2ivARB (GLenum, const GLint *);
+GLAPI void APIENTRY glMultiTexCoord2sARB (GLenum, GLshort, GLshort);
+GLAPI void APIENTRY glMultiTexCoord2svARB (GLenum, const GLshort *);
+GLAPI void APIENTRY glMultiTexCoord3dARB (GLenum, GLdouble, GLdouble, GLdouble);
+GLAPI void APIENTRY glMultiTexCoord3dvARB (GLenum, const GLdouble *);
+GLAPI void APIENTRY glMultiTexCoord3fARB (GLenum, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glMultiTexCoord3fvARB (GLenum, const GLfloat *);
+GLAPI void APIENTRY glMultiTexCoord3iARB (GLenum, GLint, GLint, GLint);
+GLAPI void APIENTRY glMultiTexCoord3ivARB (GLenum, const GLint *);
+GLAPI void APIENTRY glMultiTexCoord3sARB (GLenum, GLshort, GLshort, GLshort);
+GLAPI void APIENTRY glMultiTexCoord3svARB (GLenum, const GLshort *);
+GLAPI void APIENTRY glMultiTexCoord4dARB (GLenum, GLdouble, GLdouble, GLdouble, GLdouble);
+GLAPI void APIENTRY glMultiTexCoord4dvARB (GLenum, const GLdouble *);
+GLAPI void APIENTRY glMultiTexCoord4fARB (GLenum, GLfloat, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glMultiTexCoord4fvARB (GLenum, const GLfloat *);
+GLAPI void APIENTRY glMultiTexCoord4iARB (GLenum, GLint, GLint, GLint, GLint);
+GLAPI void APIENTRY glMultiTexCoord4ivARB (GLenum, const GLint *);
+GLAPI void APIENTRY glMultiTexCoord4sARB (GLenum, GLshort, GLshort, GLshort, GLshort);
+GLAPI void APIENTRY glMultiTexCoord4svARB (GLenum, const GLshort *);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD1DARBPROC) (GLenum target, GLdouble s);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD1DVARBPROC) (GLenum target, const GLdouble *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD1FARBPROC) (GLenum target, GLfloat s);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD1FVARBPROC) (GLenum target, const GLfloat *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD1IARBPROC) (GLenum target, GLint s);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD1IVARBPROC) (GLenum target, const GLint *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD1SARBPROC) (GLenum target, GLshort s);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD1SVARBPROC) (GLenum target, const GLshort *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD2DARBPROC) (GLenum target, GLdouble s, GLdouble t);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD2DVARBPROC) (GLenum target, const GLdouble *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD2FARBPROC) (GLenum target, GLfloat s, GLfloat t);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD2FVARBPROC) (GLenum target, const GLfloat *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD2IARBPROC) (GLenum target, GLint s, GLint t);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD2IVARBPROC) (GLenum target, const GLint *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD2SARBPROC) (GLenum target, GLshort s, GLshort t);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD2SVARBPROC) (GLenum target, const GLshort *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD3DARBPROC) (GLenum target, GLdouble s, GLdouble t, GLdouble r);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD3DVARBPROC) (GLenum target, const GLdouble *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD3FARBPROC) (GLenum target, GLfloat s, GLfloat t, GLfloat r);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD3FVARBPROC) (GLenum target, const GLfloat *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD3IARBPROC) (GLenum target, GLint s, GLint t, GLint r);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD3IVARBPROC) (GLenum target, const GLint *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD3SARBPROC) (GLenum target, GLshort s, GLshort t, GLshort r);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD3SVARBPROC) (GLenum target, const GLshort *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD4DARBPROC) (GLenum target, GLdouble s, GLdouble t, GLdouble r, GLdouble q);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD4DVARBPROC) (GLenum target, const GLdouble *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD4FARBPROC) (GLenum target, GLfloat s, GLfloat t, GLfloat r, GLfloat q);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD4FVARBPROC) (GLenum target, const GLfloat *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD4IARBPROC) (GLenum target, GLint s, GLint t, GLint r, GLint q);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD4IVARBPROC) (GLenum target, const GLint *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD4SARBPROC) (GLenum target, GLshort s, GLshort t, GLshort r, GLshort q);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD4SVARBPROC) (GLenum target, const GLshort *v);
+#ifndef GL_ARB_transpose_matrix
+#define GL_ARB_transpose_matrix 1
+GLAPI void APIENTRY glLoadTransposeMatrixfARB (const GLfloat *);
+GLAPI void APIENTRY glLoadTransposeMatrixdARB (const GLdouble *);
+GLAPI void APIENTRY glMultTransposeMatrixfARB (const GLfloat *);
+GLAPI void APIENTRY glMultTransposeMatrixdARB (const GLdouble *);
+#ifndef GL_ARB_multisample
+#define GL_ARB_multisample 1
+GLAPI void APIENTRY glSampleCoverageARB (GLclampf, GLboolean);
+typedef void (APIENTRYP PFNGLSAMPLECOVERAGEARBPROC) (GLclampf value, GLboolean invert);
+#ifndef GL_ARB_texture_env_add
+#define GL_ARB_texture_env_add 1
+#ifndef GL_ARB_texture_cube_map
+#define GL_ARB_texture_cube_map 1
+#ifndef GL_ARB_texture_compression
+#define GL_ARB_texture_compression 1
+GLAPI void APIENTRY glCompressedTexImage3DARB (GLenum, GLint, GLenum, GLsizei, GLsizei, GLsizei, GLint, GLsizei, const GLvoid *);
+GLAPI void APIENTRY glCompressedTexImage2DARB (GLenum, GLint, GLenum, GLsizei, GLsizei, GLint, GLsizei, const GLvoid *);
+GLAPI void APIENTRY glCompressedTexImage1DARB (GLenum, GLint, GLenum, GLsizei, GLint, GLsizei, const GLvoid *);
+GLAPI void APIENTRY glCompressedTexSubImage3DARB (GLenum, GLint, GLint, GLint, GLint, GLsizei, GLsizei, GLsizei, GLenum, GLsizei, const GLvoid *);
+GLAPI void APIENTRY glCompressedTexSubImage2DARB (GLenum, GLint, GLint, GLint, GLsizei, GLsizei, GLenum, GLsizei, const GLvoid *);
+GLAPI void APIENTRY glCompressedTexSubImage1DARB (GLenum, GLint, GLint, GLsizei, GLenum, GLsizei, const GLvoid *);
+GLAPI void APIENTRY glGetCompressedTexImageARB (GLenum, GLint, GLvoid *);
+typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE3DARBPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const GLvoid *data);
+typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE2DARBPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const GLvoid *data);
+typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE1DARBPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const GLvoid *data);
+typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE3DARBPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const GLvoid *data);
+typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE2DARBPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const GLvoid *data);
+typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE1DARBPROC) (GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const GLvoid *data);
+typedef void (APIENTRYP PFNGLGETCOMPRESSEDTEXIMAGEARBPROC) (GLenum target, GLint level, GLvoid *img);
+#ifndef GL_ARB_texture_border_clamp
+#define GL_ARB_texture_border_clamp 1
+#ifndef GL_ARB_point_parameters
+#define GL_ARB_point_parameters 1
+GLAPI void APIENTRY glPointParameterfARB (GLenum, GLfloat);
+GLAPI void APIENTRY glPointParameterfvARB (GLenum, const GLfloat *);
+typedef void (APIENTRYP PFNGLPOINTPARAMETERFARBPROC) (GLenum pname, GLfloat param);
+typedef void (APIENTRYP PFNGLPOINTPARAMETERFVARBPROC) (GLenum pname, const GLfloat *params);
+#ifndef GL_ARB_vertex_blend
+#define GL_ARB_vertex_blend 1
+GLAPI void APIENTRY glWeightbvARB (GLint, const GLbyte *);
+GLAPI void APIENTRY glWeightsvARB (GLint, const GLshort *);
+GLAPI void APIENTRY glWeightivARB (GLint, const GLint *);
+GLAPI void APIENTRY glWeightfvARB (GLint, const GLfloat *);
+GLAPI void APIENTRY glWeightdvARB (GLint, const GLdouble *);
+GLAPI void APIENTRY glWeightubvARB (GLint, const GLubyte *);
+GLAPI void APIENTRY glWeightusvARB (GLint, const GLushort *);
+GLAPI void APIENTRY glWeightuivARB (GLint, const GLuint *);
+GLAPI void APIENTRY glWeightPointerARB (GLint, GLenum, GLsizei, const GLvoid *);
+GLAPI void APIENTRY glVertexBlendARB (GLint);
+typedef void (APIENTRYP PFNGLWEIGHTBVARBPROC) (GLint size, const GLbyte *weights);
+typedef void (APIENTRYP PFNGLWEIGHTSVARBPROC) (GLint size, const GLshort *weights);
+typedef void (APIENTRYP PFNGLWEIGHTIVARBPROC) (GLint size, const GLint *weights);
+typedef void (APIENTRYP PFNGLWEIGHTFVARBPROC) (GLint size, const GLfloat *weights);
+typedef void (APIENTRYP PFNGLWEIGHTDVARBPROC) (GLint size, const GLdouble *weights);
+typedef void (APIENTRYP PFNGLWEIGHTUBVARBPROC) (GLint size, const GLubyte *weights);
+typedef void (APIENTRYP PFNGLWEIGHTUSVARBPROC) (GLint size, const GLushort *weights);
+typedef void (APIENTRYP PFNGLWEIGHTUIVARBPROC) (GLint size, const GLuint *weights);
+typedef void (APIENTRYP PFNGLWEIGHTPOINTERARBPROC) (GLint size, GLenum type, GLsizei stride, const GLvoid *pointer);
+#ifndef GL_ARB_matrix_palette
+#define GL_ARB_matrix_palette 1
+GLAPI void APIENTRY glCurrentPaletteMatrixARB (GLint);
+GLAPI void APIENTRY glMatrixIndexubvARB (GLint, const GLubyte *);
+GLAPI void APIENTRY glMatrixIndexusvARB (GLint, const GLushort *);
+GLAPI void APIENTRY glMatrixIndexuivARB (GLint, const GLuint *);
+GLAPI void APIENTRY glMatrixIndexPointerARB (GLint, GLenum, GLsizei, const GLvoid *);
+typedef void (APIENTRYP PFNGLMATRIXINDEXUBVARBPROC) (GLint size, const GLubyte *indices);
+typedef void (APIENTRYP PFNGLMATRIXINDEXUSVARBPROC) (GLint size, const GLushort *indices);
+typedef void (APIENTRYP PFNGLMATRIXINDEXUIVARBPROC) (GLint size, const GLuint *indices);
+typedef void (APIENTRYP PFNGLMATRIXINDEXPOINTERARBPROC) (GLint size, GLenum type, GLsizei stride, const GLvoid *pointer);
+#ifndef GL_ARB_texture_env_combine
+#define GL_ARB_texture_env_combine 1
+#ifndef GL_ARB_texture_env_crossbar
+#define GL_ARB_texture_env_crossbar 1
+#ifndef GL_ARB_texture_env_dot3
+#define GL_ARB_texture_env_dot3 1
+#ifndef GL_ARB_texture_mirrored_repeat
+#define GL_ARB_texture_mirrored_repeat 1
+#ifndef GL_ARB_depth_texture
+#define GL_ARB_depth_texture 1
+#ifndef GL_ARB_shadow
+#define GL_ARB_shadow 1
+#ifndef GL_ARB_shadow_ambient
+#define GL_ARB_shadow_ambient 1
+#ifndef GL_ARB_window_pos
+#define GL_ARB_window_pos 1
+GLAPI void APIENTRY glWindowPos2dARB (GLdouble, GLdouble);
+GLAPI void APIENTRY glWindowPos2dvARB (const GLdouble *);
+GLAPI void APIENTRY glWindowPos2fARB (GLfloat, GLfloat);
+GLAPI void APIENTRY glWindowPos2fvARB (const GLfloat *);
+GLAPI void APIENTRY glWindowPos2iARB (GLint, GLint);
+GLAPI void APIENTRY glWindowPos2ivARB (const GLint *);
+GLAPI void APIENTRY glWindowPos2sARB (GLshort, GLshort);
+GLAPI void APIENTRY glWindowPos2svARB (const GLshort *);
+GLAPI void APIENTRY glWindowPos3dARB (GLdouble, GLdouble, GLdouble);
+GLAPI void APIENTRY glWindowPos3dvARB (const GLdouble *);
+GLAPI void APIENTRY glWindowPos3fARB (GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glWindowPos3fvARB (const GLfloat *);
+GLAPI void APIENTRY glWindowPos3iARB (GLint, GLint, GLint);
+GLAPI void APIENTRY glWindowPos3ivARB (const GLint *);
+GLAPI void APIENTRY glWindowPos3sARB (GLshort, GLshort, GLshort);
+GLAPI void APIENTRY glWindowPos3svARB (const GLshort *);
+typedef void (APIENTRYP PFNGLWINDOWPOS2DARBPROC) (GLdouble x, GLdouble y);
+typedef void (APIENTRYP PFNGLWINDOWPOS2DVARBPROC) (const GLdouble *v);
+typedef void (APIENTRYP PFNGLWINDOWPOS2FARBPROC) (GLfloat x, GLfloat y);
+typedef void (APIENTRYP PFNGLWINDOWPOS2FVARBPROC) (const GLfloat *v);
+typedef void (APIENTRYP PFNGLWINDOWPOS2IVARBPROC) (const GLint *v);
+typedef void (APIENTRYP PFNGLWINDOWPOS2SARBPROC) (GLshort x, GLshort y);
+typedef void (APIENTRYP PFNGLWINDOWPOS2SVARBPROC) (const GLshort *v);
+typedef void (APIENTRYP PFNGLWINDOWPOS3DARBPROC) (GLdouble x, GLdouble y, GLdouble z);
+typedef void (APIENTRYP PFNGLWINDOWPOS3DVARBPROC) (const GLdouble *v);
+typedef void (APIENTRYP PFNGLWINDOWPOS3FARBPROC) (GLfloat x, GLfloat y, GLfloat z);
+typedef void (APIENTRYP PFNGLWINDOWPOS3FVARBPROC) (const GLfloat *v);
+typedef void (APIENTRYP PFNGLWINDOWPOS3IARBPROC) (GLint x, GLint y, GLint z);
+typedef void (APIENTRYP PFNGLWINDOWPOS3IVARBPROC) (const GLint *v);
+typedef void (APIENTRYP PFNGLWINDOWPOS3SARBPROC) (GLshort x, GLshort y, GLshort z);
+typedef void (APIENTRYP PFNGLWINDOWPOS3SVARBPROC) (const GLshort *v);
+#ifndef GL_ARB_vertex_program
+#define GL_ARB_vertex_program 1
+GLAPI void APIENTRY glVertexAttrib1dARB (GLuint, GLdouble);
+GLAPI void APIENTRY glVertexAttrib1dvARB (GLuint, const GLdouble *);
+GLAPI void APIENTRY glVertexAttrib1fARB (GLuint, GLfloat);
+GLAPI void APIENTRY glVertexAttrib1fvARB (GLuint, const GLfloat *);
+GLAPI void APIENTRY glVertexAttrib1sARB (GLuint, GLshort);
+GLAPI void APIENTRY glVertexAttrib1svARB (GLuint, const GLshort *);
+GLAPI void APIENTRY glVertexAttrib2dARB (GLuint, GLdouble, GLdouble);
+GLAPI void APIENTRY glVertexAttrib2dvARB (GLuint, const GLdouble *);
+GLAPI void APIENTRY glVertexAttrib2fARB (GLuint, GLfloat, GLfloat);
+GLAPI void APIENTRY glVertexAttrib2fvARB (GLuint, const GLfloat *);
+GLAPI void APIENTRY glVertexAttrib2sARB (GLuint, GLshort, GLshort);
+GLAPI void APIENTRY glVertexAttrib2svARB (GLuint, const GLshort *);
+GLAPI void APIENTRY glVertexAttrib3dARB (GLuint, GLdouble, GLdouble, GLdouble);
+GLAPI void APIENTRY glVertexAttrib3dvARB (GLuint, const GLdouble *);
+GLAPI void APIENTRY glVertexAttrib3fARB (GLuint, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glVertexAttrib3fvARB (GLuint, const GLfloat *);
+GLAPI void APIENTRY glVertexAttrib3sARB (GLuint, GLshort, GLshort, GLshort);
+GLAPI void APIENTRY glVertexAttrib3svARB (GLuint, const GLshort *);
+GLAPI void APIENTRY glVertexAttrib4NbvARB (GLuint, const GLbyte *);
+GLAPI void APIENTRY glVertexAttrib4NivARB (GLuint, const GLint *);
+GLAPI void APIENTRY glVertexAttrib4NsvARB (GLuint, const GLshort *);
+GLAPI void APIENTRY glVertexAttrib4NubARB (GLuint, GLubyte, GLubyte, GLubyte, GLubyte);
+GLAPI void APIENTRY glVertexAttrib4NubvARB (GLuint, const GLubyte *);
+GLAPI void APIENTRY glVertexAttrib4NuivARB (GLuint, const GLuint *);
+GLAPI void APIENTRY glVertexAttrib4NusvARB (GLuint, const GLushort *);
+GLAPI void APIENTRY glVertexAttrib4bvARB (GLuint, const GLbyte *);
+GLAPI void APIENTRY glVertexAttrib4dARB (GLuint, GLdouble, GLdouble, GLdouble, GLdouble);
+GLAPI void APIENTRY glVertexAttrib4dvARB (GLuint, const GLdouble *);
+GLAPI void APIENTRY glVertexAttrib4fARB (GLuint, GLfloat, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glVertexAttrib4fvARB (GLuint, const GLfloat *);
+GLAPI void APIENTRY glVertexAttrib4ivARB (GLuint, const GLint *);
+GLAPI void APIENTRY glVertexAttrib4sARB (GLuint, GLshort, GLshort, GLshort, GLshort);
+GLAPI void APIENTRY glVertexAttrib4svARB (GLuint, const GLshort *);
+GLAPI void APIENTRY glVertexAttrib4ubvARB (GLuint, const GLubyte *);
+GLAPI void APIENTRY glVertexAttrib4uivARB (GLuint, const GLuint *);
+GLAPI void APIENTRY glVertexAttrib4usvARB (GLuint, const GLushort *);
+GLAPI void APIENTRY glVertexAttribPointerARB (GLuint, GLint, GLenum, GLboolean, GLsizei, const GLvoid *);
+GLAPI void APIENTRY glEnableVertexAttribArrayARB (GLuint);
+GLAPI void APIENTRY glDisableVertexAttribArrayARB (GLuint);
+GLAPI void APIENTRY glProgramStringARB (GLenum, GLenum, GLsizei, const GLvoid *);
+GLAPI void APIENTRY glBindProgramARB (GLenum, GLuint);
+GLAPI void APIENTRY glDeleteProgramsARB (GLsizei, const GLuint *);
+GLAPI void APIENTRY glGenProgramsARB (GLsizei, GLuint *);
+GLAPI void APIENTRY glProgramEnvParameter4dARB (GLenum, GLuint, GLdouble, GLdouble, GLdouble, GLdouble);
+GLAPI void APIENTRY glProgramEnvParameter4dvARB (GLenum, GLuint, const GLdouble *);
+GLAPI void APIENTRY glProgramEnvParameter4fARB (GLenum, GLuint, GLfloat, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glProgramEnvParameter4fvARB (GLenum, GLuint, const GLfloat *);
+GLAPI void APIENTRY glProgramLocalParameter4dARB (GLenum, GLuint, GLdouble, GLdouble, GLdouble, GLdouble);
+GLAPI void APIENTRY glProgramLocalParameter4dvARB (GLenum, GLuint, const GLdouble *);
+GLAPI void APIENTRY glProgramLocalParameter4fARB (GLenum, GLuint, GLfloat, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glProgramLocalParameter4fvARB (GLenum, GLuint, const GLfloat *);
+GLAPI void APIENTRY glGetProgramEnvParameterdvARB (GLenum, GLuint, GLdouble *);
+GLAPI void APIENTRY glGetProgramEnvParameterfvARB (GLenum, GLuint, GLfloat *);
+GLAPI void APIENTRY glGetProgramLocalParameterdvARB (GLenum, GLuint, GLdouble *);
+GLAPI void APIENTRY glGetProgramLocalParameterfvARB (GLenum, GLuint, GLfloat *);
+GLAPI void APIENTRY glGetProgramivARB (GLenum, GLenum, GLint *);
+GLAPI void APIENTRY glGetProgramStringARB (GLenum, GLenum, GLvoid *);
+GLAPI void APIENTRY glGetVertexAttribdvARB (GLuint, GLenum, GLdouble *);
+GLAPI void APIENTRY glGetVertexAttribfvARB (GLuint, GLenum, GLfloat *);
+GLAPI void APIENTRY glGetVertexAttribivARB (GLuint, GLenum, GLint *);
+GLAPI void APIENTRY glGetVertexAttribPointervARB (GLuint, GLenum, GLvoid* *);
+GLAPI GLboolean APIENTRY glIsProgramARB (GLuint);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB1DARBPROC) (GLuint index, GLdouble x);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB1DVARBPROC) (GLuint index, const GLdouble *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB1FARBPROC) (GLuint index, GLfloat x);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB1FVARBPROC) (GLuint index, const GLfloat *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB1SARBPROC) (GLuint index, GLshort x);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB1SVARBPROC) (GLuint index, const GLshort *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB2DARBPROC) (GLuint index, GLdouble x, GLdouble y);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB2DVARBPROC) (GLuint index, const GLdouble *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB2FARBPROC) (GLuint index, GLfloat x, GLfloat y);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB2FVARBPROC) (GLuint index, const GLfloat *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB2SARBPROC) (GLuint index, GLshort x, GLshort y);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB2SVARBPROC) (GLuint index, const GLshort *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB3DARBPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB3DVARBPROC) (GLuint index, const GLdouble *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB3FARBPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat z);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB3FVARBPROC) (GLuint index, const GLfloat *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB3SARBPROC) (GLuint index, GLshort x, GLshort y, GLshort z);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB3SVARBPROC) (GLuint index, const GLshort *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4NBVARBPROC) (GLuint index, const GLbyte *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4NIVARBPROC) (GLuint index, const GLint *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4NSVARBPROC) (GLuint index, const GLshort *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUBARBPROC) (GLuint index, GLubyte x, GLubyte y, GLubyte z, GLubyte w);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUBVARBPROC) (GLuint index, const GLubyte *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUIVARBPROC) (GLuint index, const GLuint *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUSVARBPROC) (GLuint index, const GLushort *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4BVARBPROC) (GLuint index, const GLbyte *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4DARBPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4DVARBPROC) (GLuint index, const GLdouble *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4FARBPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4FVARBPROC) (GLuint index, const GLfloat *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4IVARBPROC) (GLuint index, const GLint *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4SARBPROC) (GLuint index, GLshort x, GLshort y, GLshort z, GLshort w);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4SVARBPROC) (GLuint index, const GLshort *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4UBVARBPROC) (GLuint index, const GLubyte *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4UIVARBPROC) (GLuint index, const GLuint *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4USVARBPROC) (GLuint index, const GLushort *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIBPOINTERARBPROC) (GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride, const GLvoid *pointer);
+typedef void (APIENTRYP PFNGLPROGRAMSTRINGARBPROC) (GLenum target, GLenum format, GLsizei len, const GLvoid *string);
+typedef void (APIENTRYP PFNGLBINDPROGRAMARBPROC) (GLenum target, GLuint program);
+typedef void (APIENTRYP PFNGLDELETEPROGRAMSARBPROC) (GLsizei n, const GLuint *programs);
+typedef void (APIENTRYP PFNGLGENPROGRAMSARBPROC) (GLsizei n, GLuint *programs);
+typedef void (APIENTRYP PFNGLPROGRAMENVPARAMETER4DARBPROC) (GLenum target, GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w);
+typedef void (APIENTRYP PFNGLPROGRAMENVPARAMETER4DVARBPROC) (GLenum target, GLuint index, const GLdouble *params);
+typedef void (APIENTRYP PFNGLPROGRAMENVPARAMETER4FARBPROC) (GLenum target, GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w);
+typedef void (APIENTRYP PFNGLPROGRAMENVPARAMETER4FVARBPROC) (GLenum target, GLuint index, const GLfloat *params);
+typedef void (APIENTRYP PFNGLPROGRAMLOCALPARAMETER4DARBPROC) (GLenum target, GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w);
+typedef void (APIENTRYP PFNGLPROGRAMLOCALPARAMETER4DVARBPROC) (GLenum target, GLuint index, const GLdouble *params);
+typedef void (APIENTRYP PFNGLPROGRAMLOCALPARAMETER4FARBPROC) (GLenum target, GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w);
+typedef void (APIENTRYP PFNGLPROGRAMLOCALPARAMETER4FVARBPROC) (GLenum target, GLuint index, const GLfloat *params);
+typedef void (APIENTRYP PFNGLGETPROGRAMENVPARAMETERDVARBPROC) (GLenum target, GLuint index, GLdouble *params);
+typedef void (APIENTRYP PFNGLGETPROGRAMENVPARAMETERFVARBPROC) (GLenum target, GLuint index, GLfloat *params);
+typedef void (APIENTRYP PFNGLGETPROGRAMLOCALPARAMETERDVARBPROC) (GLenum target, GLuint index, GLdouble *params);
+typedef void (APIENTRYP PFNGLGETPROGRAMLOCALPARAMETERFVARBPROC) (GLenum target, GLuint index, GLfloat *params);
+typedef void (APIENTRYP PFNGLGETPROGRAMIVARBPROC) (GLenum target, GLenum pname, GLint *params);
+typedef void (APIENTRYP PFNGLGETPROGRAMSTRINGARBPROC) (GLenum target, GLenum pname, GLvoid *string);
+typedef void (APIENTRYP PFNGLGETVERTEXATTRIBDVARBPROC) (GLuint index, GLenum pname, GLdouble *params);
+typedef void (APIENTRYP PFNGLGETVERTEXATTRIBFVARBPROC) (GLuint index, GLenum pname, GLfloat *params);
+typedef void (APIENTRYP PFNGLGETVERTEXATTRIBIVARBPROC) (GLuint index, GLenum pname, GLint *params);
+typedef void (APIENTRYP PFNGLGETVERTEXATTRIBPOINTERVARBPROC) (GLuint index, GLenum pname, GLvoid* *pointer);
+typedef GLboolean (APIENTRYP PFNGLISPROGRAMARBPROC) (GLuint program);
+#ifndef GL_ARB_fragment_program
+#define GL_ARB_fragment_program 1
+/* All ARB_fragment_program entry points are shared with ARB_vertex_program. */
+#ifndef GL_ARB_vertex_buffer_object
+#define GL_ARB_vertex_buffer_object 1
+GLAPI void APIENTRY glBindBufferARB (GLenum, GLuint);
+GLAPI void APIENTRY glDeleteBuffersARB (GLsizei, const GLuint *);
+GLAPI void APIENTRY glGenBuffersARB (GLsizei, GLuint *);
+GLAPI GLboolean APIENTRY glIsBufferARB (GLuint);
+GLAPI void APIENTRY glBufferDataARB (GLenum, GLsizeiptrARB, const GLvoid *, GLenum);
+GLAPI void APIENTRY glBufferSubDataARB (GLenum, GLintptrARB, GLsizeiptrARB, const GLvoid *);
+GLAPI void APIENTRY glGetBufferSubDataARB (GLenum, GLintptrARB, GLsizeiptrARB, GLvoid *);
+GLAPI GLvoid* APIENTRY glMapBufferARB (GLenum, GLenum);
+GLAPI GLboolean APIENTRY glUnmapBufferARB (GLenum);
+GLAPI void APIENTRY glGetBufferParameterivARB (GLenum, GLenum, GLint *);
+GLAPI void APIENTRY glGetBufferPointervARB (GLenum, GLenum, GLvoid* *);
+typedef void (APIENTRYP PFNGLBINDBUFFERARBPROC) (GLenum target, GLuint buffer);
+typedef void (APIENTRYP PFNGLDELETEBUFFERSARBPROC) (GLsizei n, const GLuint *buffers);
+typedef void (APIENTRYP PFNGLGENBUFFERSARBPROC) (GLsizei n, GLuint *buffers);
+typedef GLboolean (APIENTRYP PFNGLISBUFFERARBPROC) (GLuint buffer);
+typedef void (APIENTRYP PFNGLBUFFERDATAARBPROC) (GLenum target, GLsizeiptrARB size, const GLvoid *data, GLenum usage);
+typedef void (APIENTRYP PFNGLBUFFERSUBDATAARBPROC) (GLenum target, GLintptrARB offset, GLsizeiptrARB size, const GLvoid *data);
+typedef void (APIENTRYP PFNGLGETBUFFERSUBDATAARBPROC) (GLenum target, GLintptrARB offset, GLsizeiptrARB size, GLvoid *data);
+typedef GLvoid* (APIENTRYP PFNGLMAPBUFFERARBPROC) (GLenum target, GLenum access);
+typedef void (APIENTRYP PFNGLGETBUFFERPARAMETERIVARBPROC) (GLenum target, GLenum pname, GLint *params);
+typedef void (APIENTRYP PFNGLGETBUFFERPOINTERVARBPROC) (GLenum target, GLenum pname, GLvoid* *params);
+#ifndef GL_ARB_occlusion_query
+#define GL_ARB_occlusion_query 1
+GLAPI void APIENTRY glGenQueriesARB (GLsizei, GLuint *);
+GLAPI void APIENTRY glDeleteQueriesARB (GLsizei, const GLuint *);
+GLAPI GLboolean APIENTRY glIsQueryARB (GLuint);
+GLAPI void APIENTRY glBeginQueryARB (GLenum, GLuint);
+GLAPI void APIENTRY glEndQueryARB (GLenum);
+GLAPI void APIENTRY glGetQueryivARB (GLenum, GLenum, GLint *);
+GLAPI void APIENTRY glGetQueryObjectivARB (GLuint, GLenum, GLint *);
+GLAPI void APIENTRY glGetQueryObjectuivARB (GLuint, GLenum, GLuint *);
+typedef void (APIENTRYP PFNGLGENQUERIESARBPROC) (GLsizei n, GLuint *ids);
+typedef void (APIENTRYP PFNGLDELETEQUERIESARBPROC) (GLsizei n, const GLuint *ids);
+typedef void (APIENTRYP PFNGLBEGINQUERYARBPROC) (GLenum target, GLuint id);
+typedef void (APIENTRYP PFNGLENDQUERYARBPROC) (GLenum target);
+typedef void (APIENTRYP PFNGLGETQUERYIVARBPROC) (GLenum target, GLenum pname, GLint *params);
+typedef void (APIENTRYP PFNGLGETQUERYOBJECTIVARBPROC) (GLuint id, GLenum pname, GLint *params);
+typedef void (APIENTRYP PFNGLGETQUERYOBJECTUIVARBPROC) (GLuint id, GLenum pname, GLuint *params);
+#ifndef GL_ARB_shader_objects
+#define GL_ARB_shader_objects 1
+GLAPI void APIENTRY glDeleteObjectARB (GLhandleARB);
+GLAPI GLhandleARB APIENTRY glGetHandleARB (GLenum);
+GLAPI void APIENTRY glDetachObjectARB (GLhandleARB, GLhandleARB);
+GLAPI GLhandleARB APIENTRY glCreateShaderObjectARB (GLenum);
+GLAPI void APIENTRY glShaderSourceARB (GLhandleARB, GLsizei, const GLcharARB* *, const GLint *);
+GLAPI void APIENTRY glCompileShaderARB (GLhandleARB);
+GLAPI GLhandleARB APIENTRY glCreateProgramObjectARB (void);
+GLAPI void APIENTRY glAttachObjectARB (GLhandleARB, GLhandleARB);
+GLAPI void APIENTRY glLinkProgramARB (GLhandleARB);
+GLAPI void APIENTRY glUseProgramObjectARB (GLhandleARB);
+GLAPI void APIENTRY glValidateProgramARB (GLhandleARB);
+GLAPI void APIENTRY glUniform1fARB (GLint, GLfloat);
+GLAPI void APIENTRY glUniform2fARB (GLint, GLfloat, GLfloat);
+GLAPI void APIENTRY glUniform3fARB (GLint, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glUniform4fARB (GLint, GLfloat, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glUniform1iARB (GLint, GLint);
+GLAPI void APIENTRY glUniform2iARB (GLint, GLint, GLint);
+GLAPI void APIENTRY glUniform3iARB (GLint, GLint, GLint, GLint);
+GLAPI void APIENTRY glUniform4iARB (GLint, GLint, GLint, GLint, GLint);
+GLAPI void APIENTRY glUniform1fvARB (GLint, GLsizei, const GLfloat *);
+GLAPI void APIENTRY glUniform2fvARB (GLint, GLsizei, const GLfloat *);
+GLAPI void APIENTRY glUniform3fvARB (GLint, GLsizei, const GLfloat *);
+GLAPI void APIENTRY glUniform4fvARB (GLint, GLsizei, const GLfloat *);
+GLAPI void APIENTRY glUniform1ivARB (GLint, GLsizei, const GLint *);
+GLAPI void APIENTRY glUniform2ivARB (GLint, GLsizei, const GLint *);
+GLAPI void APIENTRY glUniform3ivARB (GLint, GLsizei, const GLint *);
+GLAPI void APIENTRY glUniform4ivARB (GLint, GLsizei, const GLint *);
+GLAPI void APIENTRY glUniformMatrix2fvARB (GLint, GLsizei, GLboolean, const GLfloat *);
+GLAPI void APIENTRY glUniformMatrix3fvARB (GLint, GLsizei, GLboolean, const GLfloat *);
+GLAPI void APIENTRY glUniformMatrix4fvARB (GLint, GLsizei, GLboolean, const GLfloat *);
+GLAPI void APIENTRY glGetObjectParameterfvARB (GLhandleARB, GLenum, GLfloat *);
+GLAPI void APIENTRY glGetObjectParameterivARB (GLhandleARB, GLenum, GLint *);
+GLAPI void APIENTRY glGetInfoLogARB (GLhandleARB, GLsizei, GLsizei *, GLcharARB *);
+GLAPI void APIENTRY glGetAttachedObjectsARB (GLhandleARB, GLsizei, GLsizei *, GLhandleARB *);
+GLAPI GLint APIENTRY glGetUniformLocationARB (GLhandleARB, const GLcharARB *);
+GLAPI void APIENTRY glGetActiveUniformARB (GLhandleARB, GLuint, GLsizei, GLsizei *, GLint *, GLenum *, GLcharARB *);
+GLAPI void APIENTRY glGetUniformfvARB (GLhandleARB, GLint, GLfloat *);
+GLAPI void APIENTRY glGetUniformivARB (GLhandleARB, GLint, GLint *);
+GLAPI void APIENTRY glGetShaderSourceARB (GLhandleARB, GLsizei, GLsizei *, GLcharARB *);
+typedef void (APIENTRYP PFNGLDETACHOBJECTARBPROC) (GLhandleARB containerObj, GLhandleARB attachedObj);
+typedef void (APIENTRYP PFNGLSHADERSOURCEARBPROC) (GLhandleARB shaderObj, GLsizei count, const GLcharARB* *string, const GLint *length);
+typedef void (APIENTRYP PFNGLATTACHOBJECTARBPROC) (GLhandleARB containerObj, GLhandleARB obj);
+typedef void (APIENTRYP PFNGLUNIFORM1FARBPROC) (GLint location, GLfloat v0);
+typedef void (APIENTRYP PFNGLUNIFORM2FARBPROC) (GLint location, GLfloat v0, GLfloat v1);
+typedef void (APIENTRYP PFNGLUNIFORM3FARBPROC) (GLint location, GLfloat v0, GLfloat v1, GLfloat v2);
+typedef void (APIENTRYP PFNGLUNIFORM4FARBPROC) (GLint location, GLfloat v0, GLfloat v1, GLfloat v2, GLfloat v3);
+typedef void (APIENTRYP PFNGLUNIFORM1IARBPROC) (GLint location, GLint v0);
+typedef void (APIENTRYP PFNGLUNIFORM2IARBPROC) (GLint location, GLint v0, GLint v1);
+typedef void (APIENTRYP PFNGLUNIFORM3IARBPROC) (GLint location, GLint v0, GLint v1, GLint v2);
+typedef void (APIENTRYP PFNGLUNIFORM4IARBPROC) (GLint location, GLint v0, GLint v1, GLint v2, GLint v3);
+typedef void (APIENTRYP PFNGLUNIFORM1FVARBPROC) (GLint location, GLsizei count, const GLfloat *value);
+typedef void (APIENTRYP PFNGLUNIFORM2FVARBPROC) (GLint location, GLsizei count, const GLfloat *value);
+typedef void (APIENTRYP PFNGLUNIFORM3FVARBPROC) (GLint location, GLsizei count, const GLfloat *value);
+typedef void (APIENTRYP PFNGLUNIFORM4FVARBPROC) (GLint location, GLsizei count, const GLfloat *value);
+typedef void (APIENTRYP PFNGLUNIFORM1IVARBPROC) (GLint location, GLsizei count, const GLint *value);
+typedef void (APIENTRYP PFNGLUNIFORM2IVARBPROC) (GLint location, GLsizei count, const GLint *value);
+typedef void (APIENTRYP PFNGLUNIFORM3IVARBPROC) (GLint location, GLsizei count, const GLint *value);
+typedef void (APIENTRYP PFNGLUNIFORM4IVARBPROC) (GLint location, GLsizei count, const GLint *value);
+typedef void (APIENTRYP PFNGLUNIFORMMATRIX2FVARBPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value);
+typedef void (APIENTRYP PFNGLUNIFORMMATRIX3FVARBPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value);
+typedef void (APIENTRYP PFNGLUNIFORMMATRIX4FVARBPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value);
+typedef void (APIENTRYP PFNGLGETOBJECTPARAMETERFVARBPROC) (GLhandleARB obj, GLenum pname, GLfloat *params);
+typedef void (APIENTRYP PFNGLGETOBJECTPARAMETERIVARBPROC) (GLhandleARB obj, GLenum pname, GLint *params);
+typedef void (APIENTRYP PFNGLGETINFOLOGARBPROC) (GLhandleARB obj, GLsizei maxLength, GLsizei *length, GLcharARB *infoLog);
+typedef void (APIENTRYP PFNGLGETATTACHEDOBJECTSARBPROC) (GLhandleARB containerObj, GLsizei maxCount, GLsizei *count, GLhandleARB *obj);
+typedef GLint (APIENTRYP PFNGLGETUNIFORMLOCATIONARBPROC) (GLhandleARB programObj, const GLcharARB *name);
+typedef void (APIENTRYP PFNGLGETACTIVEUNIFORMARBPROC) (GLhandleARB programObj, GLuint index, GLsizei maxLength, GLsizei *length, GLint *size, GLenum *type, GLcharARB *name);
+typedef void (APIENTRYP PFNGLGETUNIFORMFVARBPROC) (GLhandleARB programObj, GLint location, GLfloat *params);
+typedef void (APIENTRYP PFNGLGETUNIFORMIVARBPROC) (GLhandleARB programObj, GLint location, GLint *params);
+typedef void (APIENTRYP PFNGLGETSHADERSOURCEARBPROC) (GLhandleARB obj, GLsizei maxLength, GLsizei *length, GLcharARB *source);
+#ifndef GL_ARB_vertex_shader
+#define GL_ARB_vertex_shader 1
+GLAPI void APIENTRY glBindAttribLocationARB (GLhandleARB, GLuint, const GLcharARB *);
+GLAPI void APIENTRY glGetActiveAttribARB (GLhandleARB, GLuint, GLsizei, GLsizei *, GLint *, GLenum *, GLcharARB *);
+GLAPI GLint APIENTRY glGetAttribLocationARB (GLhandleARB, const GLcharARB *);
+typedef void (APIENTRYP PFNGLBINDATTRIBLOCATIONARBPROC) (GLhandleARB programObj, GLuint index, const GLcharARB *name);
+typedef void (APIENTRYP PFNGLGETACTIVEATTRIBARBPROC) (GLhandleARB programObj, GLuint index, GLsizei maxLength, GLsizei *length, GLint *size, GLenum *type, GLcharARB *name);
+typedef GLint (APIENTRYP PFNGLGETATTRIBLOCATIONARBPROC) (GLhandleARB programObj, const GLcharARB *name);
+#ifndef GL_ARB_fragment_shader
+#define GL_ARB_fragment_shader 1
+#ifndef GL_ARB_shading_language_100
+#define GL_ARB_shading_language_100 1
+#ifndef GL_ARB_texture_non_power_of_two
+#define GL_ARB_texture_non_power_of_two 1
+#ifndef GL_ARB_point_sprite
+#define GL_ARB_point_sprite 1
+#ifndef GL_ARB_fragment_program_shadow
+#define GL_ARB_fragment_program_shadow 1
+#ifndef GL_ARB_draw_buffers
+#define GL_ARB_draw_buffers 1
+GLAPI void APIENTRY glDrawBuffersARB (GLsizei, const GLenum *);
+typedef void (APIENTRYP PFNGLDRAWBUFFERSARBPROC) (GLsizei n, const GLenum *bufs);
+#ifndef GL_ARB_texture_rectangle
+#define GL_ARB_texture_rectangle 1
+#ifndef GL_ARB_color_buffer_float
+#define GL_ARB_color_buffer_float 1
+GLAPI void APIENTRY glClampColorARB (GLenum, GLenum);
+typedef void (APIENTRYP PFNGLCLAMPCOLORARBPROC) (GLenum target, GLenum clamp);
+#ifndef GL_ARB_half_float_pixel
+#define GL_ARB_half_float_pixel 1
+#ifndef GL_ARB_texture_float
+#define GL_ARB_texture_float 1
+#ifndef GL_ARB_pixel_buffer_object
+#define GL_ARB_pixel_buffer_object 1
+#ifndef GL_EXT_abgr
+#define GL_EXT_abgr 1
+#ifndef GL_EXT_blend_color
+#define GL_EXT_blend_color 1
+GLAPI void APIENTRY glBlendColorEXT (GLclampf, GLclampf, GLclampf, GLclampf);
+typedef void (APIENTRYP PFNGLBLENDCOLOREXTPROC) (GLclampf red, GLclampf green, GLclampf blue, GLclampf alpha);
+#ifndef GL_EXT_polygon_offset
+#define GL_EXT_polygon_offset 1
+GLAPI void APIENTRY glPolygonOffsetEXT (GLfloat, GLfloat);
+typedef void (APIENTRYP PFNGLPOLYGONOFFSETEXTPROC) (GLfloat factor, GLfloat bias);
+#ifndef GL_EXT_texture
+#define GL_EXT_texture 1
+#ifndef GL_EXT_texture3D
+#define GL_EXT_texture3D 1
+GLAPI void APIENTRY glTexImage3DEXT (GLenum, GLint, GLenum, GLsizei, GLsizei, GLsizei, GLint, GLenum, GLenum, const GLvoid *);
+GLAPI void APIENTRY glTexSubImage3DEXT (GLenum, GLint, GLint, GLint, GLint, GLsizei, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *);
+typedef void (APIENTRYP PFNGLTEXIMAGE3DEXTPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const GLvoid *pixels);
+typedef void (APIENTRYP PFNGLTEXSUBIMAGE3DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const GLvoid *pixels);
+#ifndef GL_SGIS_texture_filter4
+#define GL_SGIS_texture_filter4 1
+GLAPI void APIENTRY glGetTexFilterFuncSGIS (GLenum, GLenum, GLfloat *);
+GLAPI void APIENTRY glTexFilterFuncSGIS (GLenum, GLenum, GLsizei, const GLfloat *);
+typedef void (APIENTRYP PFNGLGETTEXFILTERFUNCSGISPROC) (GLenum target, GLenum filter, GLfloat *weights);
+typedef void (APIENTRYP PFNGLTEXFILTERFUNCSGISPROC) (GLenum target, GLenum filter, GLsizei n, const GLfloat *weights);
+#ifndef GL_EXT_subtexture
+#define GL_EXT_subtexture 1
+GLAPI void APIENTRY glTexSubImage1DEXT (GLenum, GLint, GLint, GLsizei, GLenum, GLenum, const GLvoid *);
+GLAPI void APIENTRY glTexSubImage2DEXT (GLenum, GLint, GLint, GLint, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *);
+typedef void (APIENTRYP PFNGLTEXSUBIMAGE1DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLenum type, const GLvoid *pixels);
+typedef void (APIENTRYP PFNGLTEXSUBIMAGE2DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *pixels);
+#ifndef GL_EXT_copy_texture
+#define GL_EXT_copy_texture 1
+GLAPI void APIENTRY glCopyTexImage1DEXT (GLenum, GLint, GLenum, GLint, GLint, GLsizei, GLint);
+GLAPI void APIENTRY glCopyTexImage2DEXT (GLenum, GLint, GLenum, GLint, GLint, GLsizei, GLsizei, GLint);
+GLAPI void APIENTRY glCopyTexSubImage1DEXT (GLenum, GLint, GLint, GLint, GLint, GLsizei);
+GLAPI void APIENTRY glCopyTexSubImage2DEXT (GLenum, GLint, GLint, GLint, GLint, GLint, GLsizei, GLsizei);
+GLAPI void APIENTRY glCopyTexSubImage3DEXT (GLenum, GLint, GLint, GLint, GLint, GLint, GLint, GLsizei, GLsizei);
+typedef void (APIENTRYP PFNGLCOPYTEXIMAGE1DEXTPROC) (GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLint border);
+typedef void (APIENTRYP PFNGLCOPYTEXIMAGE2DEXTPROC) (GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height, GLint border);
+typedef void (APIENTRYP PFNGLCOPYTEXSUBIMAGE1DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLint x, GLint y, GLsizei width);
+typedef void (APIENTRYP PFNGLCOPYTEXSUBIMAGE2DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint x, GLint y, GLsizei width, GLsizei height);
+typedef void (APIENTRYP PFNGLCOPYTEXSUBIMAGE3DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint x, GLint y, GLsizei width, GLsizei height);
+#ifndef GL_EXT_histogram
+#define GL_EXT_histogram 1
+GLAPI void APIENTRY glGetHistogramEXT (GLenum, GLboolean, GLenum, GLenum, GLvoid *);
+GLAPI void APIENTRY glGetHistogramParameterfvEXT (GLenum, GLenum, GLfloat *);
+GLAPI void APIENTRY glGetHistogramParameterivEXT (GLenum, GLenum, GLint *);
+GLAPI void APIENTRY glGetMinmaxEXT (GLenum, GLboolean, GLenum, GLenum, GLvoid *);
+GLAPI void APIENTRY glGetMinmaxParameterfvEXT (GLenum, GLenum, GLfloat *);
+GLAPI void APIENTRY glGetMinmaxParameterivEXT (GLenum, GLenum, GLint *);
+GLAPI void APIENTRY glHistogramEXT (GLenum, GLsizei, GLenum, GLboolean);
+GLAPI void APIENTRY glMinmaxEXT (GLenum, GLenum, GLboolean);
+GLAPI void APIENTRY glResetHistogramEXT (GLenum);
+GLAPI void APIENTRY glResetMinmaxEXT (GLenum);
+typedef void (APIENTRYP PFNGLGETHISTOGRAMEXTPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, GLvoid *values);
+typedef void (APIENTRYP PFNGLGETHISTOGRAMPARAMETERFVEXTPROC) (GLenum target, GLenum pname, GLfloat *params);
+typedef void (APIENTRYP PFNGLGETHISTOGRAMPARAMETERIVEXTPROC) (GLenum target, GLenum pname, GLint *params);
+typedef void (APIENTRYP PFNGLGETMINMAXEXTPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, GLvoid *values);
+typedef void (APIENTRYP PFNGLGETMINMAXPARAMETERFVEXTPROC) (GLenum target, GLenum pname, GLfloat *params);
+typedef void (APIENTRYP PFNGLGETMINMAXPARAMETERIVEXTPROC) (GLenum target, GLenum pname, GLint *params);
+typedef void (APIENTRYP PFNGLHISTOGRAMEXTPROC) (GLenum target, GLsizei width, GLenum internalformat, GLboolean sink);
+typedef void (APIENTRYP PFNGLMINMAXEXTPROC) (GLenum target, GLenum internalformat, GLboolean sink);
+#ifndef GL_EXT_convolution
+#define GL_EXT_convolution 1
+GLAPI void APIENTRY glConvolutionFilter1DEXT (GLenum, GLenum, GLsizei, GLenum, GLenum, const GLvoid *);
+GLAPI void APIENTRY glConvolutionFilter2DEXT (GLenum, GLenum, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *);
+GLAPI void APIENTRY glConvolutionParameterfEXT (GLenum, GLenum, GLfloat);
+GLAPI void APIENTRY glConvolutionParameterfvEXT (GLenum, GLenum, const GLfloat *);
+GLAPI void APIENTRY glConvolutionParameteriEXT (GLenum, GLenum, GLint);
+GLAPI void APIENTRY glConvolutionParameterivEXT (GLenum, GLenum, const GLint *);
+GLAPI void APIENTRY glCopyConvolutionFilter1DEXT (GLenum, GLenum, GLint, GLint, GLsizei);
+GLAPI void APIENTRY glCopyConvolutionFilter2DEXT (GLenum, GLenum, GLint, GLint, GLsizei, GLsizei);
+GLAPI void APIENTRY glGetConvolutionFilterEXT (GLenum, GLenum, GLenum, GLvoid *);
+GLAPI void APIENTRY glGetConvolutionParameterfvEXT (GLenum, GLenum, GLfloat *);
+GLAPI void APIENTRY glGetConvolutionParameterivEXT (GLenum, GLenum, GLint *);
+GLAPI void APIENTRY glGetSeparableFilterEXT (GLenum, GLenum, GLenum, GLvoid *, GLvoid *, GLvoid *);
+GLAPI void APIENTRY glSeparableFilter2DEXT (GLenum, GLenum, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *, const GLvoid *);
+typedef void (APIENTRYP PFNGLCONVOLUTIONFILTER1DEXTPROC) (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const GLvoid *image);
+typedef void (APIENTRYP PFNGLCONVOLUTIONFILTER2DEXTPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *image);
+typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERFEXTPROC) (GLenum target, GLenum pname, GLfloat params);
+typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERFVEXTPROC) (GLenum target, GLenum pname, const GLfloat *params);
+typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERIEXTPROC) (GLenum target, GLenum pname, GLint params);
+typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERIVEXTPROC) (GLenum target, GLenum pname, const GLint *params);
+typedef void (APIENTRYP PFNGLCOPYCONVOLUTIONFILTER1DEXTPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width);
+typedef void (APIENTRYP PFNGLCOPYCONVOLUTIONFILTER2DEXTPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height);
+typedef void (APIENTRYP PFNGLGETCONVOLUTIONFILTEREXTPROC) (GLenum target, GLenum format, GLenum type, GLvoid *image);
+typedef void (APIENTRYP PFNGLGETCONVOLUTIONPARAMETERFVEXTPROC) (GLenum target, GLenum pname, GLfloat *params);
+typedef void (APIENTRYP PFNGLGETCONVOLUTIONPARAMETERIVEXTPROC) (GLenum target, GLenum pname, GLint *params);
+typedef void (APIENTRYP PFNGLGETSEPARABLEFILTEREXTPROC) (GLenum target, GLenum format, GLenum type, GLvoid *row, GLvoid *column, GLvoid *span);
+typedef void (APIENTRYP PFNGLSEPARABLEFILTER2DEXTPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *row, const GLvoid *column);
+#ifndef GL_EXT_color_matrix
+#define GL_EXT_color_matrix 1
+#ifndef GL_SGI_color_table
+#define GL_SGI_color_table 1
+GLAPI void APIENTRY glColorTableSGI (GLenum, GLenum, GLsizei, GLenum, GLenum, const GLvoid *);
+GLAPI void APIENTRY glColorTableParameterfvSGI (GLenum, GLenum, const GLfloat *);
+GLAPI void APIENTRY glColorTableParameterivSGI (GLenum, GLenum, const GLint *);
+GLAPI void APIENTRY glCopyColorTableSGI (GLenum, GLenum, GLint, GLint, GLsizei);
+GLAPI void APIENTRY glGetColorTableSGI (GLenum, GLenum, GLenum, GLvoid *);
+GLAPI void APIENTRY glGetColorTableParameterfvSGI (GLenum, GLenum, GLfloat *);
+GLAPI void APIENTRY glGetColorTableParameterivSGI (GLenum, GLenum, GLint *);
+typedef void (APIENTRYP PFNGLCOLORTABLESGIPROC) (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const GLvoid *table);
+typedef void (APIENTRYP PFNGLCOLORTABLEPARAMETERFVSGIPROC) (GLenum target, GLenum pname, const GLfloat *params);
+typedef void (APIENTRYP PFNGLCOLORTABLEPARAMETERIVSGIPROC) (GLenum target, GLenum pname, const GLint *params);
+typedef void (APIENTRYP PFNGLCOPYCOLORTABLESGIPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width);
+typedef void (APIENTRYP PFNGLGETCOLORTABLESGIPROC) (GLenum target, GLenum format, GLenum type, GLvoid *table);
+typedef void (APIENTRYP PFNGLGETCOLORTABLEPARAMETERFVSGIPROC) (GLenum target, GLenum pname, GLfloat *params);
+typedef void (APIENTRYP PFNGLGETCOLORTABLEPARAMETERIVSGIPROC) (GLenum target, GLenum pname, GLint *params);
+#ifndef GL_SGIX_pixel_texture
+#define GL_SGIX_pixel_texture 1
+GLAPI void APIENTRY glPixelTexGenSGIX (GLenum);
+#ifndef GL_SGIS_pixel_texture
+#define GL_SGIS_pixel_texture 1
+GLAPI void APIENTRY glPixelTexGenParameteriSGIS (GLenum, GLint);
+GLAPI void APIENTRY glPixelTexGenParameterivSGIS (GLenum, const GLint *);
+GLAPI void APIENTRY glPixelTexGenParameterfSGIS (GLenum, GLfloat);
+GLAPI void APIENTRY glPixelTexGenParameterfvSGIS (GLenum, const GLfloat *);
+GLAPI void APIENTRY glGetPixelTexGenParameterivSGIS (GLenum, GLint *);
+GLAPI void APIENTRY glGetPixelTexGenParameterfvSGIS (GLenum, GLfloat *);
+typedef void (APIENTRYP PFNGLPIXELTEXGENPARAMETERIVSGISPROC) (GLenum pname, const GLint *params);
+typedef void (APIENTRYP PFNGLPIXELTEXGENPARAMETERFVSGISPROC) (GLenum pname, const GLfloat *params);
+#ifndef GL_SGIS_texture4D
+#define GL_SGIS_texture4D 1
+GLAPI void APIENTRY glTexImage4DSGIS (GLenum, GLint, GLenum, GLsizei, GLsizei, GLsizei, GLsizei, GLint, GLenum, GLenum, const GLvoid *);
+GLAPI void APIENTRY glTexSubImage4DSGIS (GLenum, GLint, GLint, GLint, GLint, GLint, GLsizei, GLsizei, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *);
+typedef void (APIENTRYP PFNGLTEXIMAGE4DSGISPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLsizei size4d, GLint border, GLenum format, GLenum type, const GLvoid *pixels);
+typedef void (APIENTRYP PFNGLTEXSUBIMAGE4DSGISPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint woffset, GLsizei width, GLsizei height, GLsizei depth, GLsizei size4d, GLenum format, GLenum type, const GLvoid *pixels);
+#ifndef GL_SGI_texture_color_table
+#define GL_SGI_texture_color_table 1
+#ifndef GL_EXT_cmyka
+#define GL_EXT_cmyka 1
+#ifndef GL_EXT_texture_object
+#define GL_EXT_texture_object 1
+GLAPI GLboolean APIENTRY glAreTexturesResidentEXT (GLsizei, const GLuint *, GLboolean *);
+GLAPI void APIENTRY glBindTextureEXT (GLenum, GLuint);
+GLAPI void APIENTRY glDeleteTexturesEXT (GLsizei, const GLuint *);
+GLAPI void APIENTRY glGenTexturesEXT (GLsizei, GLuint *);
+GLAPI GLboolean APIENTRY glIsTextureEXT (GLuint);
+GLAPI void APIENTRY glPrioritizeTexturesEXT (GLsizei, const GLuint *, const GLclampf *);
+typedef GLboolean (APIENTRYP PFNGLARETEXTURESRESIDENTEXTPROC) (GLsizei n, const GLuint *textures, GLboolean *residences);
+typedef void (APIENTRYP PFNGLBINDTEXTUREEXTPROC) (GLenum target, GLuint texture);
+typedef void (APIENTRYP PFNGLDELETETEXTURESEXTPROC) (GLsizei n, const GLuint *textures);
+typedef void (APIENTRYP PFNGLGENTEXTURESEXTPROC) (GLsizei n, GLuint *textures);
+typedef GLboolean (APIENTRYP PFNGLISTEXTUREEXTPROC) (GLuint texture);
+typedef void (APIENTRYP PFNGLPRIORITIZETEXTURESEXTPROC) (GLsizei n, const GLuint *textures, const GLclampf *priorities);
+#ifndef GL_SGIS_detail_texture
+#define GL_SGIS_detail_texture 1
+GLAPI void APIENTRY glDetailTexFuncSGIS (GLenum, GLsizei, const GLfloat *);
+GLAPI void APIENTRY glGetDetailTexFuncSGIS (GLenum, GLfloat *);
+typedef void (APIENTRYP PFNGLDETAILTEXFUNCSGISPROC) (GLenum target, GLsizei n, const GLfloat *points);
+typedef void (APIENTRYP PFNGLGETDETAILTEXFUNCSGISPROC) (GLenum target, GLfloat *points);
+#ifndef GL_SGIS_sharpen_texture
+#define GL_SGIS_sharpen_texture 1
+GLAPI void APIENTRY glSharpenTexFuncSGIS (GLenum, GLsizei, const GLfloat *);
+GLAPI void APIENTRY glGetSharpenTexFuncSGIS (GLenum, GLfloat *);
+typedef void (APIENTRYP PFNGLSHARPENTEXFUNCSGISPROC) (GLenum target, GLsizei n, const GLfloat *points);
+typedef void (APIENTRYP PFNGLGETSHARPENTEXFUNCSGISPROC) (GLenum target, GLfloat *points);
+#ifndef GL_EXT_packed_pixels
+#define GL_EXT_packed_pixels 1
+#ifndef GL_SGIS_texture_lod
+#define GL_SGIS_texture_lod 1
+#ifndef GL_SGIS_multisample
+#define GL_SGIS_multisample 1
+GLAPI void APIENTRY glSampleMaskSGIS (GLclampf, GLboolean);
+GLAPI void APIENTRY glSamplePatternSGIS (GLenum);
+typedef void (APIENTRYP PFNGLSAMPLEMASKSGISPROC) (GLclampf value, GLboolean invert);
+#ifndef GL_EXT_rescale_normal
+#define GL_EXT_rescale_normal 1
+#ifndef GL_EXT_vertex_array
+#define GL_EXT_vertex_array 1
+GLAPI void APIENTRY glArrayElementEXT (GLint);
+GLAPI void APIENTRY glColorPointerEXT (GLint, GLenum, GLsizei, GLsizei, const GLvoid *);
+GLAPI void APIENTRY glDrawArraysEXT (GLenum, GLint, GLsizei);
+GLAPI void APIENTRY glEdgeFlagPointerEXT (GLsizei, GLsizei, const GLboolean *);
+GLAPI void APIENTRY glGetPointervEXT (GLenum, GLvoid* *);
+GLAPI void APIENTRY glIndexPointerEXT (GLenum, GLsizei, GLsizei, const GLvoid *);
+GLAPI void APIENTRY glNormalPointerEXT (GLenum, GLsizei, GLsizei, const GLvoid *);
+GLAPI void APIENTRY glTexCoordPointerEXT (GLint, GLenum, GLsizei, GLsizei, const GLvoid *);
+GLAPI void APIENTRY glVertexPointerEXT (GLint, GLenum, GLsizei, GLsizei, const GLvoid *);
+typedef void (APIENTRYP PFNGLCOLORPOINTEREXTPROC) (GLint size, GLenum type, GLsizei stride, GLsizei count, const GLvoid *pointer);
+typedef void (APIENTRYP PFNGLDRAWARRAYSEXTPROC) (GLenum mode, GLint first, GLsizei count);
+typedef void (APIENTRYP PFNGLEDGEFLAGPOINTEREXTPROC) (GLsizei stride, GLsizei count, const GLboolean *pointer);
+typedef void (APIENTRYP PFNGLGETPOINTERVEXTPROC) (GLenum pname, GLvoid* *params);
+typedef void (APIENTRYP PFNGLINDEXPOINTEREXTPROC) (GLenum type, GLsizei stride, GLsizei count, const GLvoid *pointer);
+typedef void (APIENTRYP PFNGLNORMALPOINTEREXTPROC) (GLenum type, GLsizei stride, GLsizei count, const GLvoid *pointer);
+typedef void (APIENTRYP PFNGLTEXCOORDPOINTEREXTPROC) (GLint size, GLenum type, GLsizei stride, GLsizei count, const GLvoid *pointer);
+typedef void (APIENTRYP PFNGLVERTEXPOINTEREXTPROC) (GLint size, GLenum type, GLsizei stride, GLsizei count, const GLvoid *pointer);
+#ifndef GL_EXT_misc_attribute
+#define GL_EXT_misc_attribute 1
+#ifndef GL_SGIS_generate_mipmap
+#define GL_SGIS_generate_mipmap 1
+#ifndef GL_SGIX_clipmap
+#define GL_SGIX_clipmap 1
+#ifndef GL_SGIX_shadow
+#define GL_SGIX_shadow 1
+#ifndef GL_SGIS_texture_edge_clamp
+#define GL_SGIS_texture_edge_clamp 1
+#ifndef GL_SGIS_texture_border_clamp
+#define GL_SGIS_texture_border_clamp 1
+#ifndef GL_EXT_blend_minmax
+#define GL_EXT_blend_minmax 1
+GLAPI void APIENTRY glBlendEquationEXT (GLenum);
+#ifndef GL_EXT_blend_subtract
+#define GL_EXT_blend_subtract 1
+#ifndef GL_EXT_blend_logic_op
+#define GL_EXT_blend_logic_op 1
+#ifndef GL_SGIX_interlace
+#define GL_SGIX_interlace 1
+#ifndef GL_SGIX_pixel_tiles
+#define GL_SGIX_pixel_tiles 1
+#ifndef GL_SGIX_texture_select
+#define GL_SGIX_texture_select 1
+#ifndef GL_SGIX_sprite
+#define GL_SGIX_sprite 1
+GLAPI void APIENTRY glSpriteParameterfSGIX (GLenum, GLfloat);
+GLAPI void APIENTRY glSpriteParameterfvSGIX (GLenum, const GLfloat *);
+GLAPI void APIENTRY glSpriteParameteriSGIX (GLenum, GLint);
+GLAPI void APIENTRY glSpriteParameterivSGIX (GLenum, const GLint *);
+typedef void (APIENTRYP PFNGLSPRITEPARAMETERFSGIXPROC) (GLenum pname, GLfloat param);
+typedef void (APIENTRYP PFNGLSPRITEPARAMETERFVSGIXPROC) (GLenum pname, const GLfloat *params);
+typedef void (APIENTRYP PFNGLSPRITEPARAMETERISGIXPROC) (GLenum pname, GLint param);
+typedef void (APIENTRYP PFNGLSPRITEPARAMETERIVSGIXPROC) (GLenum pname, const GLint *params);
+#ifndef GL_SGIX_texture_multi_buffer
+#define GL_SGIX_texture_multi_buffer 1
+#ifndef GL_EXT_point_parameters
+#define GL_EXT_point_parameters 1
+GLAPI void APIENTRY glPointParameterfEXT (GLenum, GLfloat);
+GLAPI void APIENTRY glPointParameterfvEXT (GLenum, const GLfloat *);
+typedef void (APIENTRYP PFNGLPOINTPARAMETERFEXTPROC) (GLenum pname, GLfloat param);
+typedef void (APIENTRYP PFNGLPOINTPARAMETERFVEXTPROC) (GLenum pname, const GLfloat *params);
+#ifndef GL_SGIS_point_parameters
+#define GL_SGIS_point_parameters 1
+GLAPI void APIENTRY glPointParameterfSGIS (GLenum, GLfloat);
+GLAPI void APIENTRY glPointParameterfvSGIS (GLenum, const GLfloat *);
+typedef void (APIENTRYP PFNGLPOINTPARAMETERFSGISPROC) (GLenum pname, GLfloat param);
+typedef void (APIENTRYP PFNGLPOINTPARAMETERFVSGISPROC) (GLenum pname, const GLfloat *params);
+#ifndef GL_SGIX_instruments
+#define GL_SGIX_instruments 1
+GLAPI GLint APIENTRY glGetInstrumentsSGIX (void);
+GLAPI void APIENTRY glInstrumentsBufferSGIX (GLsizei, GLint *);
+GLAPI GLint APIENTRY glPollInstrumentsSGIX (GLint *);
+GLAPI void APIENTRY glReadInstrumentsSGIX (GLint);
+GLAPI void APIENTRY glStartInstrumentsSGIX (void);
+GLAPI void APIENTRY glStopInstrumentsSGIX (GLint);
+typedef void (APIENTRYP PFNGLINSTRUMENTSBUFFERSGIXPROC) (GLsizei size, GLint *buffer);
+#ifndef GL_SGIX_texture_scale_bias
+#define GL_SGIX_texture_scale_bias 1
+#ifndef GL_SGIX_framezoom
+#define GL_SGIX_framezoom 1
+GLAPI void APIENTRY glFrameZoomSGIX (GLint);
+#ifndef GL_SGIX_tag_sample_buffer
+#define GL_SGIX_tag_sample_buffer 1
+GLAPI void APIENTRY glTagSampleBufferSGIX (void);
+#ifndef GL_SGIX_polynomial_ffd
+#define GL_SGIX_polynomial_ffd 1
+GLAPI void APIENTRY glDeformationMap3dSGIX (GLenum, GLdouble, GLdouble, GLint, GLint, GLdouble, GLdouble, GLint, GLint, GLdouble, GLdouble, GLint, GLint, const GLdouble *);
+GLAPI void APIENTRY glDeformationMap3fSGIX (GLenum, GLfloat, GLfloat, GLint, GLint, GLfloat, GLfloat, GLint, GLint, GLfloat, GLfloat, GLint, GLint, const GLfloat *);
+GLAPI void APIENTRY glDeformSGIX (GLbitfield);
+GLAPI void APIENTRY glLoadIdentityDeformationMapSGIX (GLbitfield);
+typedef void (APIENTRYP PFNGLDEFORMATIONMAP3DSGIXPROC) (GLenum target, GLdouble u1, GLdouble u2, GLint ustride, GLint uorder, GLdouble v1, GLdouble v2, GLint vstride, GLint vorder, GLdouble w1, GLdouble w2, GLint wstride, GLint worder, const GLdouble *points);
+typedef void (APIENTRYP PFNGLDEFORMATIONMAP3FSGIXPROC) (GLenum target, GLfloat u1, GLfloat u2, GLint ustride, GLint uorder, GLfloat v1, GLfloat v2, GLint vstride, GLint vorder, GLfloat w1, GLfloat w2, GLint wstride, GLint worder, const GLfloat *points);
+typedef void (APIENTRYP PFNGLDEFORMSGIXPROC) (GLbitfield mask);
+#ifndef GL_SGIX_reference_plane
+#define GL_SGIX_reference_plane 1
+GLAPI void APIENTRY glReferencePlaneSGIX (const GLdouble *);
+typedef void (APIENTRYP PFNGLREFERENCEPLANESGIXPROC) (const GLdouble *equation);
+#ifndef GL_SGIX_flush_raster
+#define GL_SGIX_flush_raster 1
+GLAPI void APIENTRY glFlushRasterSGIX (void);
+#ifndef GL_SGIX_depth_texture
+#define GL_SGIX_depth_texture 1
+#ifndef GL_SGIS_fog_function
+#define GL_SGIS_fog_function 1
+GLAPI void APIENTRY glFogFuncSGIS (GLsizei, const GLfloat *);
+GLAPI void APIENTRY glGetFogFuncSGIS (GLfloat *);
+typedef void (APIENTRYP PFNGLFOGFUNCSGISPROC) (GLsizei n, const GLfloat *points);
+typedef void (APIENTRYP PFNGLGETFOGFUNCSGISPROC) (GLfloat *points);
+#ifndef GL_SGIX_fog_offset
+#define GL_SGIX_fog_offset 1
+#ifndef GL_HP_image_transform
+#define GL_HP_image_transform 1
+GLAPI void APIENTRY glImageTransformParameteriHP (GLenum, GLenum, GLint);
+GLAPI void APIENTRY glImageTransformParameterfHP (GLenum, GLenum, GLfloat);
+GLAPI void APIENTRY glImageTransformParameterivHP (GLenum, GLenum, const GLint *);
+GLAPI void APIENTRY glImageTransformParameterfvHP (GLenum, GLenum, const GLfloat *);
+GLAPI void APIENTRY glGetImageTransformParameterivHP (GLenum, GLenum, GLint *);
+GLAPI void APIENTRY glGetImageTransformParameterfvHP (GLenum, GLenum, GLfloat *);
+typedef void (APIENTRYP PFNGLIMAGETRANSFORMPARAMETERIHPPROC) (GLenum target, GLenum pname, GLint param);
+typedef void (APIENTRYP PFNGLIMAGETRANSFORMPARAMETERFHPPROC) (GLenum target, GLenum pname, GLfloat param);
+typedef void (APIENTRYP PFNGLIMAGETRANSFORMPARAMETERIVHPPROC) (GLenum target, GLenum pname, const GLint *params);
+typedef void (APIENTRYP PFNGLIMAGETRANSFORMPARAMETERFVHPPROC) (GLenum target, GLenum pname, const GLfloat *params);
+typedef void (APIENTRYP PFNGLGETIMAGETRANSFORMPARAMETERIVHPPROC) (GLenum target, GLenum pname, GLint *params);
+typedef void (APIENTRYP PFNGLGETIMAGETRANSFORMPARAMETERFVHPPROC) (GLenum target, GLenum pname, GLfloat *params);
+#ifndef GL_HP_convolution_border_modes
+#define GL_HP_convolution_border_modes 1
+#ifndef GL_SGIX_texture_add_env
+#define GL_SGIX_texture_add_env 1
+#ifndef GL_EXT_color_subtable
+#define GL_EXT_color_subtable 1
+GLAPI void APIENTRY glColorSubTableEXT (GLenum, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *);
+GLAPI void APIENTRY glCopyColorSubTableEXT (GLenum, GLsizei, GLint, GLint, GLsizei);
+typedef void (APIENTRYP PFNGLCOLORSUBTABLEEXTPROC) (GLenum target, GLsizei start, GLsizei count, GLenum format, GLenum type, const GLvoid *data);
+typedef void (APIENTRYP PFNGLCOPYCOLORSUBTABLEEXTPROC) (GLenum target, GLsizei start, GLint x, GLint y, GLsizei width);
+#ifndef GL_PGI_vertex_hints
+#define GL_PGI_vertex_hints 1
+#ifndef GL_PGI_misc_hints
+#define GL_PGI_misc_hints 1
+GLAPI void APIENTRY glHintPGI (GLenum, GLint);
+typedef void (APIENTRYP PFNGLHINTPGIPROC) (GLenum target, GLint mode);
+#ifndef GL_EXT_paletted_texture
+#define GL_EXT_paletted_texture 1
+GLAPI void APIENTRY glColorTableEXT (GLenum, GLenum, GLsizei, GLenum, GLenum, const GLvoid *);
+GLAPI void APIENTRY glGetColorTableEXT (GLenum, GLenum, GLenum, GLvoid *);
+GLAPI void APIENTRY glGetColorTableParameterivEXT (GLenum, GLenum, GLint *);
+GLAPI void APIENTRY glGetColorTableParameterfvEXT (GLenum, GLenum, GLfloat *);
+typedef void (APIENTRYP PFNGLCOLORTABLEEXTPROC) (GLenum target, GLenum internalFormat, GLsizei width, GLenum format, GLenum type, const GLvoid *table);
+typedef void (APIENTRYP PFNGLGETCOLORTABLEEXTPROC) (GLenum target, GLenum format, GLenum type, GLvoid *data);
+typedef void (APIENTRYP PFNGLGETCOLORTABLEPARAMETERIVEXTPROC) (GLenum target, GLenum pname, GLint *params);
+typedef void (APIENTRYP PFNGLGETCOLORTABLEPARAMETERFVEXTPROC) (GLenum target, GLenum pname, GLfloat *params);
+#ifndef GL_EXT_clip_volume_hint
+#define GL_EXT_clip_volume_hint 1
+#ifndef GL_SGIX_list_priority
+#define GL_SGIX_list_priority 1
+GLAPI void APIENTRY glGetListParameterfvSGIX (GLuint, GLenum, GLfloat *);
+GLAPI void APIENTRY glGetListParameterivSGIX (GLuint, GLenum, GLint *);
+GLAPI void APIENTRY glListParameterfSGIX (GLuint, GLenum, GLfloat);
+GLAPI void APIENTRY glListParameterfvSGIX (GLuint, GLenum, const GLfloat *);
+GLAPI void APIENTRY glListParameteriSGIX (GLuint, GLenum, GLint);
+GLAPI void APIENTRY glListParameterivSGIX (GLuint, GLenum, const GLint *);
+typedef void (APIENTRYP PFNGLGETLISTPARAMETERFVSGIXPROC) (GLuint list, GLenum pname, GLfloat *params);
+typedef void (APIENTRYP PFNGLGETLISTPARAMETERIVSGIXPROC) (GLuint list, GLenum pname, GLint *params);
+typedef void (APIENTRYP PFNGLLISTPARAMETERFSGIXPROC) (GLuint list, GLenum pname, GLfloat param);
+typedef void (APIENTRYP PFNGLLISTPARAMETERFVSGIXPROC) (GLuint list, GLenum pname, const GLfloat *params);
+typedef void (APIENTRYP PFNGLLISTPARAMETERISGIXPROC) (GLuint list, GLenum pname, GLint param);
+typedef void (APIENTRYP PFNGLLISTPARAMETERIVSGIXPROC) (GLuint list, GLenum pname, const GLint *params);
+#ifndef GL_SGIX_ir_instrument1
+#define GL_SGIX_ir_instrument1 1
+#ifndef GL_SGIX_calligraphic_fragment
+#define GL_SGIX_calligraphic_fragment 1
+#ifndef GL_SGIX_texture_lod_bias
+#define GL_SGIX_texture_lod_bias 1
+#ifndef GL_SGIX_shadow_ambient
+#define GL_SGIX_shadow_ambient 1
+#ifndef GL_EXT_index_texture
+#define GL_EXT_index_texture 1
+#ifndef GL_EXT_index_material
+#define GL_EXT_index_material 1
+GLAPI void APIENTRY glIndexMaterialEXT (GLenum, GLenum);
+typedef void (APIENTRYP PFNGLINDEXMATERIALEXTPROC) (GLenum face, GLenum mode);
+#ifndef GL_EXT_index_func
+#define GL_EXT_index_func 1
+GLAPI void APIENTRY glIndexFuncEXT (GLenum, GLclampf);
+typedef void (APIENTRYP PFNGLINDEXFUNCEXTPROC) (GLenum func, GLclampf ref);
+#ifndef GL_EXT_index_array_formats
+#define GL_EXT_index_array_formats 1
+#ifndef GL_EXT_compiled_vertex_array
+#define GL_EXT_compiled_vertex_array 1
+GLAPI void APIENTRY glLockArraysEXT (GLint, GLsizei);
+GLAPI void APIENTRY glUnlockArraysEXT (void);
+typedef void (APIENTRYP PFNGLLOCKARRAYSEXTPROC) (GLint first, GLsizei count);
+#ifndef GL_EXT_cull_vertex
+#define GL_EXT_cull_vertex 1
+GLAPI void APIENTRY glCullParameterdvEXT (GLenum, GLdouble *);
+GLAPI void APIENTRY glCullParameterfvEXT (GLenum, GLfloat *);
+typedef void (APIENTRYP PFNGLCULLPARAMETERDVEXTPROC) (GLenum pname, GLdouble *params);
+typedef void (APIENTRYP PFNGLCULLPARAMETERFVEXTPROC) (GLenum pname, GLfloat *params);
+#ifndef GL_SGIX_ycrcb
+#define GL_SGIX_ycrcb 1
+#ifndef GL_SGIX_fragment_lighting
+#define GL_SGIX_fragment_lighting 1
+GLAPI void APIENTRY glFragmentColorMaterialSGIX (GLenum, GLenum);
+GLAPI void APIENTRY glFragmentLightfSGIX (GLenum, GLenum, GLfloat);
+GLAPI void APIENTRY glFragmentLightfvSGIX (GLenum, GLenum, const GLfloat *);
+GLAPI void APIENTRY glFragmentLightiSGIX (GLenum, GLenum, GLint);
+GLAPI void APIENTRY glFragmentLightivSGIX (GLenum, GLenum, const GLint *);
+GLAPI void APIENTRY glFragmentLightModelfSGIX (GLenum, GLfloat);
+GLAPI void APIENTRY glFragmentLightModelfvSGIX (GLenum, const GLfloat *);
+GLAPI void APIENTRY glFragmentLightModeliSGIX (GLenum, GLint);
+GLAPI void APIENTRY glFragmentLightModelivSGIX (GLenum, const GLint *);
+GLAPI void APIENTRY glFragmentMaterialfSGIX (GLenum, GLenum, GLfloat);
+GLAPI void APIENTRY glFragmentMaterialfvSGIX (GLenum, GLenum, const GLfloat *);
+GLAPI void APIENTRY glFragmentMaterialiSGIX (GLenum, GLenum, GLint);
+GLAPI void APIENTRY glFragmentMaterialivSGIX (GLenum, GLenum, const GLint *);
+GLAPI void APIENTRY glGetFragmentLightfvSGIX (GLenum, GLenum, GLfloat *);
+GLAPI void APIENTRY glGetFragmentLightivSGIX (GLenum, GLenum, GLint *);
+GLAPI void APIENTRY glGetFragmentMaterialfvSGIX (GLenum, GLenum, GLfloat *);
+GLAPI void APIENTRY glGetFragmentMaterialivSGIX (GLenum, GLenum, GLint *);
+GLAPI void APIENTRY glLightEnviSGIX (GLenum, GLint);
+typedef void (APIENTRYP PFNGLFRAGMENTLIGHTFSGIXPROC) (GLenum light, GLenum pname, GLfloat param);
+typedef void (APIENTRYP PFNGLFRAGMENTLIGHTFVSGIXPROC) (GLenum light, GLenum pname, const GLfloat *params);
+typedef void (APIENTRYP PFNGLFRAGMENTLIGHTISGIXPROC) (GLenum light, GLenum pname, GLint param);
+typedef void (APIENTRYP PFNGLFRAGMENTLIGHTIVSGIXPROC) (GLenum light, GLenum pname, const GLint *params);
+typedef void (APIENTRYP PFNGLFRAGMENTLIGHTMODELFVSGIXPROC) (GLenum pname, const GLfloat *params);
+typedef void (APIENTRYP PFNGLFRAGMENTLIGHTMODELIVSGIXPROC) (GLenum pname, const GLint *params);
+typedef void (APIENTRYP PFNGLFRAGMENTMATERIALFSGIXPROC) (GLenum face, GLenum pname, GLfloat param);
+typedef void (APIENTRYP PFNGLFRAGMENTMATERIALFVSGIXPROC) (GLenum face, GLenum pname, const GLfloat *params);
+typedef void (APIENTRYP PFNGLFRAGMENTMATERIALISGIXPROC) (GLenum face, GLenum pname, GLint param);
+typedef void (APIENTRYP PFNGLFRAGMENTMATERIALIVSGIXPROC) (GLenum face, GLenum pname, const GLint *params);
+typedef void (APIENTRYP PFNGLGETFRAGMENTLIGHTFVSGIXPROC) (GLenum light, GLenum pname, GLfloat *params);
+typedef void (APIENTRYP PFNGLGETFRAGMENTLIGHTIVSGIXPROC) (GLenum light, GLenum pname, GLint *params);
+typedef void (APIENTRYP PFNGLGETFRAGMENTMATERIALFVSGIXPROC) (GLenum face, GLenum pname, GLfloat *params);
+typedef void (APIENTRYP PFNGLGETFRAGMENTMATERIALIVSGIXPROC) (GLenum face, GLenum pname, GLint *params);
+typedef void (APIENTRYP PFNGLLIGHTENVISGIXPROC) (GLenum pname, GLint param);
+#ifndef GL_IBM_rasterpos_clip
+#define GL_IBM_rasterpos_clip 1
+#ifndef GL_HP_texture_lighting
+#define GL_HP_texture_lighting 1
+#ifndef GL_EXT_draw_range_elements
+#define GL_EXT_draw_range_elements 1
+GLAPI void APIENTRY glDrawRangeElementsEXT (GLenum, GLuint, GLuint, GLsizei, GLenum, const GLvoid *);
+typedef void (APIENTRYP PFNGLDRAWRANGEELEMENTSEXTPROC) (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, const GLvoid *indices);
+#ifndef GL_WIN_phong_shading
+#define GL_WIN_phong_shading 1
+#ifndef GL_WIN_specular_fog
+#define GL_WIN_specular_fog 1
+#ifndef GL_EXT_light_texture
+#define GL_EXT_light_texture 1
+GLAPI void APIENTRY glApplyTextureEXT (GLenum);
+GLAPI void APIENTRY glTextureLightEXT (GLenum);
+GLAPI void APIENTRY glTextureMaterialEXT (GLenum, GLenum);
+typedef void (APIENTRYP PFNGLTEXTUREMATERIALEXTPROC) (GLenum face, GLenum mode);
+#ifndef GL_SGIX_blend_alpha_minmax
+#define GL_SGIX_blend_alpha_minmax 1
+#ifndef GL_EXT_bgra
+#define GL_EXT_bgra 1
+#ifndef GL_SGIX_async
+#define GL_SGIX_async 1
+GLAPI void APIENTRY glAsyncMarkerSGIX (GLuint);
+GLAPI GLint APIENTRY glFinishAsyncSGIX (GLuint *);
+GLAPI GLint APIENTRY glPollAsyncSGIX (GLuint *);
+GLAPI GLuint APIENTRY glGenAsyncMarkersSGIX (GLsizei);
+GLAPI void APIENTRY glDeleteAsyncMarkersSGIX (GLuint, GLsizei);
+GLAPI GLboolean APIENTRY glIsAsyncMarkerSGIX (GLuint);
+typedef void (APIENTRYP PFNGLDELETEASYNCMARKERSSGIXPROC) (GLuint marker, GLsizei range);
+#ifndef GL_SGIX_async_pixel
+#define GL_SGIX_async_pixel 1
+#ifndef GL_SGIX_async_histogram
+#define GL_SGIX_async_histogram 1
+#ifndef GL_INTEL_parallel_arrays
+#define GL_INTEL_parallel_arrays 1
+GLAPI void APIENTRY glVertexPointervINTEL (GLint, GLenum, const GLvoid* *);
+GLAPI void APIENTRY glNormalPointervINTEL (GLenum, const GLvoid* *);
+GLAPI void APIENTRY glColorPointervINTEL (GLint, GLenum, const GLvoid* *);
+GLAPI void APIENTRY glTexCoordPointervINTEL (GLint, GLenum, const GLvoid* *);
+typedef void (APIENTRYP PFNGLVERTEXPOINTERVINTELPROC) (GLint size, GLenum type, const GLvoid* *pointer);
+typedef void (APIENTRYP PFNGLNORMALPOINTERVINTELPROC) (GLenum type, const GLvoid* *pointer);
+typedef void (APIENTRYP PFNGLCOLORPOINTERVINTELPROC) (GLint size, GLenum type, const GLvoid* *pointer);
+typedef void (APIENTRYP PFNGLTEXCOORDPOINTERVINTELPROC) (GLint size, GLenum type, const GLvoid* *pointer);
+#ifndef GL_HP_occlusion_test
+#define GL_HP_occlusion_test 1
+#ifndef GL_EXT_pixel_transform
+#define GL_EXT_pixel_transform 1
+GLAPI void APIENTRY glPixelTransformParameteriEXT (GLenum, GLenum, GLint);
+GLAPI void APIENTRY glPixelTransformParameterfEXT (GLenum, GLenum, GLfloat);
+GLAPI void APIENTRY glPixelTransformParameterivEXT (GLenum, GLenum, const GLint *);
+GLAPI void APIENTRY glPixelTransformParameterfvEXT (GLenum, GLenum, const GLfloat *);
+typedef void (APIENTRYP PFNGLPIXELTRANSFORMPARAMETERIEXTPROC) (GLenum target, GLenum pname, GLint param);
+typedef void (APIENTRYP PFNGLPIXELTRANSFORMPARAMETERFEXTPROC) (GLenum target, GLenum pname, GLfloat param);
+typedef void (APIENTRYP PFNGLPIXELTRANSFORMPARAMETERIVEXTPROC) (GLenum target, GLenum pname, const GLint *params);
+typedef void (APIENTRYP PFNGLPIXELTRANSFORMPARAMETERFVEXTPROC) (GLenum target, GLenum pname, const GLfloat *params);
+#ifndef GL_EXT_pixel_transform_color_table
+#define GL_EXT_pixel_transform_color_table 1
+#ifndef GL_EXT_shared_texture_palette
+#define GL_EXT_shared_texture_palette 1
+#ifndef GL_EXT_separate_specular_color
+#define GL_EXT_separate_specular_color 1
+#ifndef GL_EXT_secondary_color
+#define GL_EXT_secondary_color 1
+GLAPI void APIENTRY glSecondaryColor3bEXT (GLbyte, GLbyte, GLbyte);
+GLAPI void APIENTRY glSecondaryColor3bvEXT (const GLbyte *);
+GLAPI void APIENTRY glSecondaryColor3dEXT (GLdouble, GLdouble, GLdouble);
+GLAPI void APIENTRY glSecondaryColor3dvEXT (const GLdouble *);
+GLAPI void APIENTRY glSecondaryColor3fEXT (GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glSecondaryColor3fvEXT (const GLfloat *);
+GLAPI void APIENTRY glSecondaryColor3iEXT (GLint, GLint, GLint);
+GLAPI void APIENTRY glSecondaryColor3ivEXT (const GLint *);
+GLAPI void APIENTRY glSecondaryColor3sEXT (GLshort, GLshort, GLshort);
+GLAPI void APIENTRY glSecondaryColor3svEXT (const GLshort *);
+GLAPI void APIENTRY glSecondaryColor3ubEXT (GLubyte, GLubyte, GLubyte);
+GLAPI void APIENTRY glSecondaryColor3ubvEXT (const GLubyte *);
+GLAPI void APIENTRY glSecondaryColor3uiEXT (GLuint, GLuint, GLuint);
+GLAPI void APIENTRY glSecondaryColor3uivEXT (const GLuint *);
+GLAPI void APIENTRY glSecondaryColor3usEXT (GLushort, GLushort, GLushort);
+GLAPI void APIENTRY glSecondaryColor3usvEXT (const GLushort *);
+GLAPI void APIENTRY glSecondaryColorPointerEXT (GLint, GLenum, GLsizei, const GLvoid *);
+typedef void (APIENTRYP PFNGLSECONDARYCOLOR3BEXTPROC) (GLbyte red, GLbyte green, GLbyte blue);
+typedef void (APIENTRYP PFNGLSECONDARYCOLOR3DEXTPROC) (GLdouble red, GLdouble green, GLdouble blue);
+typedef void (APIENTRYP PFNGLSECONDARYCOLOR3FEXTPROC) (GLfloat red, GLfloat green, GLfloat blue);
+typedef void (APIENTRYP PFNGLSECONDARYCOLOR3IEXTPROC) (GLint red, GLint green, GLint blue);
+typedef void (APIENTRYP PFNGLSECONDARYCOLOR3SEXTPROC) (GLshort red, GLshort green, GLshort blue);
+typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UBEXTPROC) (GLubyte red, GLubyte green, GLubyte blue);
+typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UIEXTPROC) (GLuint red, GLuint green, GLuint blue);
+typedef void (APIENTRYP PFNGLSECONDARYCOLOR3USEXTPROC) (GLushort red, GLushort green, GLushort blue);
+typedef void (APIENTRYP PFNGLSECONDARYCOLORPOINTEREXTPROC) (GLint size, GLenum type, GLsizei stride, const GLvoid *pointer);
+#ifndef GL_EXT_texture_perturb_normal
+#define GL_EXT_texture_perturb_normal 1
+GLAPI void APIENTRY glTextureNormalEXT (GLenum);
+#ifndef GL_EXT_multi_draw_arrays
+#define GL_EXT_multi_draw_arrays 1
+GLAPI void APIENTRY glMultiDrawArraysEXT (GLenum, GLint *, GLsizei *, GLsizei);
+GLAPI void APIENTRY glMultiDrawElementsEXT (GLenum, const GLsizei *, GLenum, const GLvoid* *, GLsizei);
+typedef void (APIENTRYP PFNGLMULTIDRAWARRAYSEXTPROC) (GLenum mode, GLint *first, GLsizei *count, GLsizei primcount);
+typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTSEXTPROC) (GLenum mode, const GLsizei *count, GLenum type, const GLvoid* *indices, GLsizei primcount);
+#ifndef GL_EXT_fog_coord
+#define GL_EXT_fog_coord 1
+GLAPI void APIENTRY glFogCoordfEXT (GLfloat);
+GLAPI void APIENTRY glFogCoordfvEXT (const GLfloat *);
+GLAPI void APIENTRY glFogCoorddEXT (GLdouble);
+GLAPI void APIENTRY glFogCoorddvEXT (const GLdouble *);
+GLAPI void APIENTRY glFogCoordPointerEXT (GLenum, GLsizei, const GLvoid *);
+typedef void (APIENTRYP PFNGLFOGCOORDFEXTPROC) (GLfloat coord);
+typedef void (APIENTRYP PFNGLFOGCOORDFVEXTPROC) (const GLfloat *coord);
+typedef void (APIENTRYP PFNGLFOGCOORDDEXTPROC) (GLdouble coord);
+typedef void (APIENTRYP PFNGLFOGCOORDDVEXTPROC) (const GLdouble *coord);
+typedef void (APIENTRYP PFNGLFOGCOORDPOINTEREXTPROC) (GLenum type, GLsizei stride, const GLvoid *pointer);
+#ifndef GL_REND_screen_coordinates
+#define GL_REND_screen_coordinates 1
+#ifndef GL_EXT_coordinate_frame
+#define GL_EXT_coordinate_frame 1
+GLAPI void APIENTRY glTangent3bEXT (GLbyte, GLbyte, GLbyte);
+GLAPI void APIENTRY glTangent3bvEXT (const GLbyte *);
+GLAPI void APIENTRY glTangent3dEXT (GLdouble, GLdouble, GLdouble);
+GLAPI void APIENTRY glTangent3dvEXT (const GLdouble *);
+GLAPI void APIENTRY glTangent3fEXT (GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glTangent3fvEXT (const GLfloat *);
+GLAPI void APIENTRY glTangent3iEXT (GLint, GLint, GLint);
+GLAPI void APIENTRY glTangent3ivEXT (const GLint *);
+GLAPI void APIENTRY glTangent3sEXT (GLshort, GLshort, GLshort);
+GLAPI void APIENTRY glTangent3svEXT (const GLshort *);
+GLAPI void APIENTRY glBinormal3bEXT (GLbyte, GLbyte, GLbyte);
+GLAPI void APIENTRY glBinormal3bvEXT (const GLbyte *);
+GLAPI void APIENTRY glBinormal3dEXT (GLdouble, GLdouble, GLdouble);
+GLAPI void APIENTRY glBinormal3dvEXT (const GLdouble *);
+GLAPI void APIENTRY glBinormal3fEXT (GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glBinormal3fvEXT (const GLfloat *);
+GLAPI void APIENTRY glBinormal3iEXT (GLint, GLint, GLint);
+GLAPI void APIENTRY glBinormal3ivEXT (const GLint *);
+GLAPI void APIENTRY glBinormal3sEXT (GLshort, GLshort, GLshort);
+GLAPI void APIENTRY glBinormal3svEXT (const GLshort *);
+GLAPI void APIENTRY glTangentPointerEXT (GLenum, GLsizei, const GLvoid *);
+GLAPI void APIENTRY glBinormalPointerEXT (GLenum, GLsizei, const GLvoid *);
+typedef void (APIENTRYP PFNGLTANGENT3BEXTPROC) (GLbyte tx, GLbyte ty, GLbyte tz);
+typedef void (APIENTRYP PFNGLTANGENT3BVEXTPROC) (const GLbyte *v);
+typedef void (APIENTRYP PFNGLTANGENT3DEXTPROC) (GLdouble tx, GLdouble ty, GLdouble tz);
+typedef void (APIENTRYP PFNGLTANGENT3DVEXTPROC) (const GLdouble *v);
+typedef void (APIENTRYP PFNGLTANGENT3FEXTPROC) (GLfloat tx, GLfloat ty, GLfloat tz);
+typedef void (APIENTRYP PFNGLTANGENT3FVEXTPROC) (const GLfloat *v);
+typedef void (APIENTRYP PFNGLTANGENT3IEXTPROC) (GLint tx, GLint ty, GLint tz);
+typedef void (APIENTRYP PFNGLTANGENT3IVEXTPROC) (const GLint *v);
+typedef void (APIENTRYP PFNGLTANGENT3SEXTPROC) (GLshort tx, GLshort ty, GLshort tz);
+typedef void (APIENTRYP PFNGLTANGENT3SVEXTPROC) (const GLshort *v);
+typedef void (APIENTRYP PFNGLBINORMAL3BEXTPROC) (GLbyte bx, GLbyte by, GLbyte bz);
+typedef void (APIENTRYP PFNGLBINORMAL3BVEXTPROC) (const GLbyte *v);
+typedef void (APIENTRYP PFNGLBINORMAL3DEXTPROC) (GLdouble bx, GLdouble by, GLdouble bz);
+typedef void (APIENTRYP PFNGLBINORMAL3DVEXTPROC) (const GLdouble *v);
+typedef void (APIENTRYP PFNGLBINORMAL3FEXTPROC) (GLfloat bx, GLfloat by, GLfloat bz);
+typedef void (APIENTRYP PFNGLBINORMAL3FVEXTPROC) (const GLfloat *v);
+typedef void (APIENTRYP PFNGLBINORMAL3IEXTPROC) (GLint bx, GLint by, GLint bz);
+typedef void (APIENTRYP PFNGLBINORMAL3IVEXTPROC) (const GLint *v);
+typedef void (APIENTRYP PFNGLBINORMAL3SEXTPROC) (GLshort bx, GLshort by, GLshort bz);
+typedef void (APIENTRYP PFNGLBINORMAL3SVEXTPROC) (const GLshort *v);
+typedef void (APIENTRYP PFNGLTANGENTPOINTEREXTPROC) (GLenum type, GLsizei stride, const GLvoid *pointer);
+typedef void (APIENTRYP PFNGLBINORMALPOINTEREXTPROC) (GLenum type, GLsizei stride, const GLvoid *pointer);
+#ifndef GL_EXT_texture_env_combine
+#define GL_EXT_texture_env_combine 1
+#ifndef GL_APPLE_specular_vector
+#define GL_APPLE_specular_vector 1
+#ifndef GL_APPLE_transform_hint
+#define GL_APPLE_transform_hint 1
+#ifndef GL_SGIX_fog_scale
+#define GL_SGIX_fog_scale 1
+#ifndef GL_SUNX_constant_data
+#define GL_SUNX_constant_data 1
+GLAPI void APIENTRY glFinishTextureSUNX (void);
+#ifndef GL_SUN_global_alpha
+#define GL_SUN_global_alpha 1
+GLAPI void APIENTRY glGlobalAlphaFactorbSUN (GLbyte);
+GLAPI void APIENTRY glGlobalAlphaFactorsSUN (GLshort);
+GLAPI void APIENTRY glGlobalAlphaFactoriSUN (GLint);
+GLAPI void APIENTRY glGlobalAlphaFactorfSUN (GLfloat);
+GLAPI void APIENTRY glGlobalAlphaFactordSUN (GLdouble);
+GLAPI void APIENTRY glGlobalAlphaFactorubSUN (GLubyte);
+GLAPI void APIENTRY glGlobalAlphaFactorusSUN (GLushort);
+GLAPI void APIENTRY glGlobalAlphaFactoruiSUN (GLuint);
+#ifndef GL_SUN_triangle_list
+#define GL_SUN_triangle_list 1
+GLAPI void APIENTRY glReplacementCodeuiSUN (GLuint);
+GLAPI void APIENTRY glReplacementCodeusSUN (GLushort);
+GLAPI void APIENTRY glReplacementCodeubSUN (GLubyte);
+GLAPI void APIENTRY glReplacementCodeuivSUN (const GLuint *);
+GLAPI void APIENTRY glReplacementCodeusvSUN (const GLushort *);
+GLAPI void APIENTRY glReplacementCodeubvSUN (const GLubyte *);
+GLAPI void APIENTRY glReplacementCodePointerSUN (GLenum, GLsizei, const GLvoid* *);
+typedef void (APIENTRYP PFNGLREPLACEMENTCODEPOINTERSUNPROC) (GLenum type, GLsizei stride, const GLvoid* *pointer);
+#ifndef GL_SUN_vertex
+#define GL_SUN_vertex 1
+GLAPI void APIENTRY glColor4ubVertex2fSUN (GLubyte, GLubyte, GLubyte, GLubyte, GLfloat, GLfloat);
+GLAPI void APIENTRY glColor4ubVertex2fvSUN (const GLubyte *, const GLfloat *);
+GLAPI void APIENTRY glColor4ubVertex3fSUN (GLubyte, GLubyte, GLubyte, GLubyte, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glColor4ubVertex3fvSUN (const GLubyte *, const GLfloat *);
+GLAPI void APIENTRY glColor3fVertex3fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glColor3fVertex3fvSUN (const GLfloat *, const GLfloat *);
+GLAPI void APIENTRY glNormal3fVertex3fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glNormal3fVertex3fvSUN (const GLfloat *, const GLfloat *);
+GLAPI void APIENTRY glColor4fNormal3fVertex3fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glColor4fNormal3fVertex3fvSUN (const GLfloat *, const GLfloat *, const GLfloat *);
+GLAPI void APIENTRY glTexCoord2fVertex3fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glTexCoord2fVertex3fvSUN (const GLfloat *, const GLfloat *);
+GLAPI void APIENTRY glTexCoord4fVertex4fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glTexCoord4fVertex4fvSUN (const GLfloat *, const GLfloat *);
+GLAPI void APIENTRY glTexCoord2fColor4ubVertex3fSUN (GLfloat, GLfloat, GLubyte, GLubyte, GLubyte, GLubyte, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glTexCoord2fColor4ubVertex3fvSUN (const GLfloat *, const GLubyte *, const GLfloat *);
+GLAPI void APIENTRY glTexCoord2fColor3fVertex3fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glTexCoord2fColor3fVertex3fvSUN (const GLfloat *, const GLfloat *, const GLfloat *);
+GLAPI void APIENTRY glTexCoord2fNormal3fVertex3fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glTexCoord2fNormal3fVertex3fvSUN (const GLfloat *, const GLfloat *, const GLfloat *);
+GLAPI void APIENTRY glTexCoord2fColor4fNormal3fVertex3fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glTexCoord2fColor4fNormal3fVertex3fvSUN (const GLfloat *, const GLfloat *, const GLfloat *, const GLfloat *);
+GLAPI void APIENTRY glTexCoord4fColor4fNormal3fVertex4fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glTexCoord4fColor4fNormal3fVertex4fvSUN (const GLfloat *, const GLfloat *, const GLfloat *, const GLfloat *);
+GLAPI void APIENTRY glReplacementCodeuiVertex3fSUN (GLuint, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glReplacementCodeuiVertex3fvSUN (const GLuint *, const GLfloat *);
+GLAPI void APIENTRY glReplacementCodeuiColor4ubVertex3fSUN (GLuint, GLubyte, GLubyte, GLubyte, GLubyte, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glReplacementCodeuiColor4ubVertex3fvSUN (const GLuint *, const GLubyte *, const GLfloat *);
+GLAPI void APIENTRY glReplacementCodeuiColor3fVertex3fSUN (GLuint, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glReplacementCodeuiColor3fVertex3fvSUN (const GLuint *, const GLfloat *, const GLfloat *);
+GLAPI void APIENTRY glReplacementCodeuiNormal3fVertex3fSUN (GLuint, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glReplacementCodeuiNormal3fVertex3fvSUN (const GLuint *, const GLfloat *, const GLfloat *);
+GLAPI void APIENTRY glReplacementCodeuiColor4fNormal3fVertex3fSUN (GLuint, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glReplacementCodeuiColor4fNormal3fVertex3fvSUN (const GLuint *, const GLfloat *, const GLfloat *, const GLfloat *);
+GLAPI void APIENTRY glReplacementCodeuiTexCoord2fVertex3fSUN (GLuint, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glReplacementCodeuiTexCoord2fVertex3fvSUN (const GLuint *, const GLfloat *, const GLfloat *);
+GLAPI void APIENTRY glReplacementCodeuiTexCoord2fNormal3fVertex3fSUN (GLuint, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glReplacementCodeuiTexCoord2fNormal3fVertex3fvSUN (const GLuint *, const GLfloat *, const GLfloat *, const GLfloat *);
+GLAPI void APIENTRY glReplacementCodeuiTexCoord2fColor4fNormal3fVertex3fSUN (GLuint, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glReplacementCodeuiTexCoord2fColor4fNormal3fVertex3fvSUN (const GLuint *, const GLfloat *, const GLfloat *, const GLfloat *, const GLfloat *);
+typedef void (APIENTRYP PFNGLCOLOR4UBVERTEX2FSUNPROC) (GLubyte r, GLubyte g, GLubyte b, GLubyte a, GLfloat x, GLfloat y);
+typedef void (APIENTRYP PFNGLCOLOR4UBVERTEX2FVSUNPROC) (const GLubyte *c, const GLfloat *v);
+typedef void (APIENTRYP PFNGLCOLOR4UBVERTEX3FSUNPROC) (GLubyte r, GLubyte g, GLubyte b, GLubyte a, GLfloat x, GLfloat y, GLfloat z);
+typedef void (APIENTRYP PFNGLCOLOR4UBVERTEX3FVSUNPROC) (const GLubyte *c, const GLfloat *v);
+typedef void (APIENTRYP PFNGLCOLOR3FVERTEX3FSUNPROC) (GLfloat r, GLfloat g, GLfloat b, GLfloat x, GLfloat y, GLfloat z);
+typedef void (APIENTRYP PFNGLCOLOR3FVERTEX3FVSUNPROC) (const GLfloat *c, const GLfloat *v);
+typedef void (APIENTRYP PFNGLNORMAL3FVERTEX3FSUNPROC) (GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z);
+typedef void (APIENTRYP PFNGLNORMAL3FVERTEX3FVSUNPROC) (const GLfloat *n, const GLfloat *v);
+typedef void (APIENTRYP PFNGLCOLOR4FNORMAL3FVERTEX3FSUNPROC) (GLfloat r, GLfloat g, GLfloat b, GLfloat a, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z);
+typedef void (APIENTRYP PFNGLCOLOR4FNORMAL3FVERTEX3FVSUNPROC) (const GLfloat *c, const GLfloat *n, const GLfloat *v);
+typedef void (APIENTRYP PFNGLTEXCOORD2FVERTEX3FSUNPROC) (GLfloat s, GLfloat t, GLfloat x, GLfloat y, GLfloat z);
+typedef void (APIENTRYP PFNGLTEXCOORD2FVERTEX3FVSUNPROC) (const GLfloat *tc, const GLfloat *v);
+typedef void (APIENTRYP PFNGLTEXCOORD4FVERTEX4FSUNPROC) (GLfloat s, GLfloat t, GLfloat p, GLfloat q, GLfloat x, GLfloat y, GLfloat z, GLfloat w);
+typedef void (APIENTRYP PFNGLTEXCOORD4FVERTEX4FVSUNPROC) (const GLfloat *tc, const GLfloat *v);
+typedef void (APIENTRYP PFNGLTEXCOORD2FCOLOR4UBVERTEX3FSUNPROC) (GLfloat s, GLfloat t, GLubyte r, GLubyte g, GLubyte b, GLubyte a, GLfloat x, GLfloat y, GLfloat z);
+typedef void (APIENTRYP PFNGLTEXCOORD2FCOLOR4UBVERTEX3FVSUNPROC) (const GLfloat *tc, const GLubyte *c, const GLfloat *v);
+typedef void (APIENTRYP PFNGLTEXCOORD2FCOLOR3FVERTEX3FSUNPROC) (GLfloat s, GLfloat t, GLfloat r, GLfloat g, GLfloat b, GLfloat x, GLfloat y, GLfloat z);
+typedef void (APIENTRYP PFNGLTEXCOORD2FCOLOR3FVERTEX3FVSUNPROC) (const GLfloat *tc, const GLfloat *c, const GLfloat *v);
+typedef void (APIENTRYP PFNGLTEXCOORD2FNORMAL3FVERTEX3FSUNPROC) (GLfloat s, GLfloat t, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z);
+typedef void (APIENTRYP PFNGLTEXCOORD2FNORMAL3FVERTEX3FVSUNPROC) (const GLfloat *tc, const GLfloat *n, const GLfloat *v);
+typedef void (APIENTRYP PFNGLTEXCOORD2FCOLOR4FNORMAL3FVERTEX3FSUNPROC) (GLfloat s, GLfloat t, GLfloat r, GLfloat g, GLfloat b, GLfloat a, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z);
+typedef void (APIENTRYP PFNGLTEXCOORD2FCOLOR4FNORMAL3FVERTEX3FVSUNPROC) (const GLfloat *tc, const GLfloat *c, const GLfloat *n, const GLfloat *v);
+typedef void (APIENTRYP PFNGLTEXCOORD4FCOLOR4FNORMAL3FVERTEX4FSUNPROC) (GLfloat s, GLfloat t, GLfloat p, GLfloat q, GLfloat r, GLfloat g, GLfloat b, GLfloat a, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z, GLfloat w);
+typedef void (APIENTRYP PFNGLTEXCOORD4FCOLOR4FNORMAL3FVERTEX4FVSUNPROC) (const GLfloat *tc, const GLfloat *c, const GLfloat *n, const GLfloat *v);
+typedef void (APIENTRYP PFNGLREPLACEMENTCODEUIVERTEX3FSUNPROC) (GLuint rc, GLfloat x, GLfloat y, GLfloat z);
+typedef void (APIENTRYP PFNGLREPLACEMENTCODEUIVERTEX3FVSUNPROC) (const GLuint *rc, const GLfloat *v);
+typedef void (APIENTRYP PFNGLREPLACEMENTCODEUICOLOR4UBVERTEX3FSUNPROC) (GLuint rc, GLubyte r, GLubyte g, GLubyte b, GLubyte a, GLfloat x, GLfloat y, GLfloat z);
+typedef void (APIENTRYP PFNGLREPLACEMENTCODEUICOLOR4UBVERTEX3FVSUNPROC) (const GLuint *rc, const GLubyte *c, const GLfloat *v);
+typedef void (APIENTRYP PFNGLREPLACEMENTCODEUICOLOR3FVERTEX3FSUNPROC) (GLuint rc, GLfloat r, GLfloat g, GLfloat b, GLfloat x, GLfloat y, GLfloat z);
+typedef void (APIENTRYP PFNGLREPLACEMENTCODEUICOLOR3FVERTEX3FVSUNPROC) (const GLuint *rc, const GLfloat *c, const GLfloat *v);
+typedef void (APIENTRYP PFNGLREPLACEMENTCODEUINORMAL3FVERTEX3FSUNPROC) (GLuint rc, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z);
+typedef void (APIENTRYP PFNGLREPLACEMENTCODEUINORMAL3FVERTEX3FVSUNPROC) (const GLuint *rc, const GLfloat *n, const GLfloat *v);
+typedef void (APIENTRYP PFNGLREPLACEMENTCODEUICOLOR4FNORMAL3FVERTEX3FSUNPROC) (GLuint rc, GLfloat r, GLfloat g, GLfloat b, GLfloat a, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z);
+typedef void (APIENTRYP PFNGLREPLACEMENTCODEUICOLOR4FNORMAL3FVERTEX3FVSUNPROC) (const GLuint *rc, const GLfloat *c, const GLfloat *n, const GLfloat *v);
+typedef void (APIENTRYP PFNGLREPLACEMENTCODEUITEXCOORD2FVERTEX3FSUNPROC) (GLuint rc, GLfloat s, GLfloat t, GLfloat x, GLfloat y, GLfloat z);
+typedef void (APIENTRYP PFNGLREPLACEMENTCODEUITEXCOORD2FVERTEX3FVSUNPROC) (const GLuint *rc, const GLfloat *tc, const GLfloat *v);
+typedef void (APIENTRYP PFNGLREPLACEMENTCODEUITEXCOORD2FNORMAL3FVERTEX3FSUNPROC) (GLuint rc, GLfloat s, GLfloat t, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z);
+typedef void (APIENTRYP PFNGLREPLACEMENTCODEUITEXCOORD2FNORMAL3FVERTEX3FVSUNPROC) (const GLuint *rc, const GLfloat *tc, const GLfloat *n, const GLfloat *v);
+typedef void (APIENTRYP PFNGLREPLACEMENTCODEUITEXCOORD2FCOLOR4FNORMAL3FVERTEX3FSUNPROC) (GLuint rc, GLfloat s, GLfloat t, GLfloat r, GLfloat g, GLfloat b, GLfloat a, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z);
+typedef void (APIENTRYP PFNGLREPLACEMENTCODEUITEXCOORD2FCOLOR4FNORMAL3FVERTEX3FVSUNPROC) (const GLuint *rc, const GLfloat *tc, const GLfloat *c, const GLfloat *n, const GLfloat *v);
+#ifndef GL_EXT_blend_func_separate
+#define GL_EXT_blend_func_separate 1
+GLAPI void APIENTRY glBlendFuncSeparateEXT (GLenum, GLenum, GLenum, GLenum);
+typedef void (APIENTRYP PFNGLBLENDFUNCSEPARATEEXTPROC) (GLenum sfactorRGB, GLenum dfactorRGB, GLenum sfactorAlpha, GLenum dfactorAlpha);
+#ifndef GL_INGR_blend_func_separate
+#define GL_INGR_blend_func_separate 1
+GLAPI void APIENTRY glBlendFuncSeparateINGR (GLenum, GLenum, GLenum, GLenum);
+typedef void (APIENTRYP PFNGLBLENDFUNCSEPARATEINGRPROC) (GLenum sfactorRGB, GLenum dfactorRGB, GLenum sfactorAlpha, GLenum dfactorAlpha);
+#ifndef GL_INGR_color_clamp
+#define GL_INGR_color_clamp 1
+#ifndef GL_INGR_interlace_read
+#define GL_INGR_interlace_read 1
+#ifndef GL_EXT_stencil_wrap
+#define GL_EXT_stencil_wrap 1
+#ifndef GL_EXT_422_pixels
+#define GL_EXT_422_pixels 1
+#ifndef GL_NV_texgen_reflection
+#define GL_NV_texgen_reflection 1
+#ifndef GL_SUN_convolution_border_modes
+#define GL_SUN_convolution_border_modes 1
+#ifndef GL_EXT_texture_env_add
+#define GL_EXT_texture_env_add 1
+#ifndef GL_EXT_texture_lod_bias
+#define GL_EXT_texture_lod_bias 1
+#ifndef GL_EXT_texture_filter_anisotropic
+#define GL_EXT_texture_filter_anisotropic 1
+#ifndef GL_EXT_vertex_weighting
+#define GL_EXT_vertex_weighting 1
+GLAPI void APIENTRY glVertexWeightfEXT (GLfloat);
+GLAPI void APIENTRY glVertexWeightfvEXT (const GLfloat *);
+GLAPI void APIENTRY glVertexWeightPointerEXT (GLsizei, GLenum, GLsizei, const GLvoid *);
+typedef void (APIENTRYP PFNGLVERTEXWEIGHTFVEXTPROC) (const GLfloat *weight);
+typedef void (APIENTRYP PFNGLVERTEXWEIGHTPOINTEREXTPROC) (GLsizei size, GLenum type, GLsizei stride, const GLvoid *pointer);
+#ifndef GL_NV_light_max_exponent
+#define GL_NV_light_max_exponent 1
+#ifndef GL_NV_vertex_array_range
+#define GL_NV_vertex_array_range 1
+GLAPI void APIENTRY glFlushVertexArrayRangeNV (void);
+GLAPI void APIENTRY glVertexArrayRangeNV (GLsizei, const GLvoid *);
+typedef void (APIENTRYP PFNGLVERTEXARRAYRANGENVPROC) (GLsizei length, const GLvoid *pointer);
+#ifndef GL_NV_register_combiners
+#define GL_NV_register_combiners 1
+GLAPI void APIENTRY glCombinerParameterfvNV (GLenum, const GLfloat *);
+GLAPI void APIENTRY glCombinerParameterfNV (GLenum, GLfloat);
+GLAPI void APIENTRY glCombinerParameterivNV (GLenum, const GLint *);
+GLAPI void APIENTRY glCombinerParameteriNV (GLenum, GLint);
+GLAPI void APIENTRY glCombinerInputNV (GLenum, GLenum, GLenum, GLenum, GLenum, GLenum);
+GLAPI void APIENTRY glCombinerOutputNV (GLenum, GLenum, GLenum, GLenum, GLenum, GLenum, GLenum, GLboolean, GLboolean, GLboolean);
+GLAPI void APIENTRY glFinalCombinerInputNV (GLenum, GLenum, GLenum, GLenum);
+GLAPI void APIENTRY glGetCombinerInputParameterfvNV (GLenum, GLenum, GLenum, GLenum, GLfloat *);
+GLAPI void APIENTRY glGetCombinerInputParameterivNV (GLenum, GLenum, GLenum, GLenum, GLint *);
+GLAPI void APIENTRY glGetCombinerOutputParameterfvNV (GLenum, GLenum, GLenum, GLfloat *);
+GLAPI void APIENTRY glGetCombinerOutputParameterivNV (GLenum, GLenum, GLenum, GLint *);
+GLAPI void APIENTRY glGetFinalCombinerInputParameterfvNV (GLenum, GLenum, GLfloat *);
+GLAPI void APIENTRY glGetFinalCombinerInputParameterivNV (GLenum, GLenum, GLint *);
+typedef void (APIENTRYP PFNGLCOMBINERPARAMETERFVNVPROC) (GLenum pname, const GLfloat *params);
+typedef void (APIENTRYP PFNGLCOMBINERPARAMETERFNVPROC) (GLenum pname, GLfloat param);
+typedef void (APIENTRYP PFNGLCOMBINERPARAMETERIVNVPROC) (GLenum pname, const GLint *params);
+typedef void (APIENTRYP PFNGLCOMBINERPARAMETERINVPROC) (GLenum pname, GLint param);
+typedef void (APIENTRYP PFNGLCOMBINERINPUTNVPROC) (GLenum stage, GLenum portion, GLenum variable, GLenum input, GLenum mapping, GLenum componentUsage);
+typedef void (APIENTRYP PFNGLCOMBINEROUTPUTNVPROC) (GLenum stage, GLenum portion, GLenum abOutput, GLenum cdOutput, GLenum sumOutput, GLenum scale, GLenum bias, GLboolean abDotProduct, GLboolean cdDotProduct, GLboolean muxSum);
+typedef void (APIENTRYP PFNGLFINALCOMBINERINPUTNVPROC) (GLenum variable, GLenum input, GLenum mapping, GLenum componentUsage);
+typedef void (APIENTRYP PFNGLGETCOMBINERINPUTPARAMETERFVNVPROC) (GLenum stage, GLenum portion, GLenum variable, GLenum pname, GLfloat *params);
+typedef void (APIENTRYP PFNGLGETCOMBINERINPUTPARAMETERIVNVPROC) (GLenum stage, GLenum portion, GLenum variable, GLenum pname, GLint *params);
+typedef void (APIENTRYP PFNGLGETCOMBINEROUTPUTPARAMETERFVNVPROC) (GLenum stage, GLenum portion, GLenum pname, GLfloat *params);
+typedef void (APIENTRYP PFNGLGETCOMBINEROUTPUTPARAMETERIVNVPROC) (GLenum stage, GLenum portion, GLenum pname, GLint *params);
+typedef void (APIENTRYP PFNGLGETFINALCOMBINERINPUTPARAMETERFVNVPROC) (GLenum variable, GLenum pname, GLfloat *params);
+typedef void (APIENTRYP PFNGLGETFINALCOMBINERINPUTPARAMETERIVNVPROC) (GLenum variable, GLenum pname, GLint *params);
+#ifndef GL_NV_fog_distance
+#define GL_NV_fog_distance 1
+#ifndef GL_NV_texgen_emboss
+#define GL_NV_texgen_emboss 1
+#ifndef GL_NV_blend_square
+#define GL_NV_blend_square 1
+#ifndef GL_NV_texture_env_combine4
+#define GL_NV_texture_env_combine4 1
+#ifndef GL_MESA_resize_buffers
+#define GL_MESA_resize_buffers 1
+GLAPI void APIENTRY glResizeBuffersMESA (void);
+#ifndef GL_MESA_window_pos
+#define GL_MESA_window_pos 1
+GLAPI void APIENTRY glWindowPos2dMESA (GLdouble, GLdouble);
+GLAPI void APIENTRY glWindowPos2dvMESA (const GLdouble *);
+GLAPI void APIENTRY glWindowPos2fMESA (GLfloat, GLfloat);
+GLAPI void APIENTRY glWindowPos2fvMESA (const GLfloat *);
+GLAPI void APIENTRY glWindowPos2iMESA (GLint, GLint);
+GLAPI void APIENTRY glWindowPos2ivMESA (const GLint *);
+GLAPI void APIENTRY glWindowPos2sMESA (GLshort, GLshort);
+GLAPI void APIENTRY glWindowPos2svMESA (const GLshort *);
+GLAPI void APIENTRY glWindowPos3dMESA (GLdouble, GLdouble, GLdouble);
+GLAPI void APIENTRY glWindowPos3dvMESA (const GLdouble *);
+GLAPI void APIENTRY glWindowPos3fMESA (GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glWindowPos3fvMESA (const GLfloat *);
+GLAPI void APIENTRY glWindowPos3iMESA (GLint, GLint, GLint);
+GLAPI void APIENTRY glWindowPos3ivMESA (const GLint *);
+GLAPI void APIENTRY glWindowPos3sMESA (GLshort, GLshort, GLshort);
+GLAPI void APIENTRY glWindowPos3svMESA (const GLshort *);
+GLAPI void APIENTRY glWindowPos4dMESA (GLdouble, GLdouble, GLdouble, GLdouble);
+GLAPI void APIENTRY glWindowPos4dvMESA (const GLdouble *);
+GLAPI void APIENTRY glWindowPos4fMESA (GLfloat, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glWindowPos4fvMESA (const GLfloat *);
+GLAPI void APIENTRY glWindowPos4iMESA (GLint, GLint, GLint, GLint);
+GLAPI void APIENTRY glWindowPos4ivMESA (const GLint *);
+GLAPI void APIENTRY glWindowPos4sMESA (GLshort, GLshort, GLshort, GLshort);
+GLAPI void APIENTRY glWindowPos4svMESA (const GLshort *);
+typedef void (APIENTRYP PFNGLWINDOWPOS2DMESAPROC) (GLdouble x, GLdouble y);
+typedef void (APIENTRYP PFNGLWINDOWPOS2DVMESAPROC) (const GLdouble *v);
+typedef void (APIENTRYP PFNGLWINDOWPOS2FMESAPROC) (GLfloat x, GLfloat y);
+typedef void (APIENTRYP PFNGLWINDOWPOS2FVMESAPROC) (const GLfloat *v);
+typedef void (APIENTRYP PFNGLWINDOWPOS2SMESAPROC) (GLshort x, GLshort y);
+typedef void (APIENTRYP PFNGLWINDOWPOS2SVMESAPROC) (const GLshort *v);
+typedef void (APIENTRYP PFNGLWINDOWPOS3DMESAPROC) (GLdouble x, GLdouble y, GLdouble z);
+typedef void (APIENTRYP PFNGLWINDOWPOS3DVMESAPROC) (const GLdouble *v);
+typedef void (APIENTRYP PFNGLWINDOWPOS3FMESAPROC) (GLfloat x, GLfloat y, GLfloat z);
+typedef void (APIENTRYP PFNGLWINDOWPOS3FVMESAPROC) (const GLfloat *v);
+typedef void (APIENTRYP PFNGLWINDOWPOS3IMESAPROC) (GLint x, GLint y, GLint z);
+typedef void (APIENTRYP PFNGLWINDOWPOS3SMESAPROC) (GLshort x, GLshort y, GLshort z);
+typedef void (APIENTRYP PFNGLWINDOWPOS3SVMESAPROC) (const GLshort *v);
+typedef void (APIENTRYP PFNGLWINDOWPOS4DMESAPROC) (GLdouble x, GLdouble y, GLdouble z, GLdouble w);
+typedef void (APIENTRYP PFNGLWINDOWPOS4DVMESAPROC) (const GLdouble *v);
+typedef void (APIENTRYP PFNGLWINDOWPOS4FMESAPROC) (GLfloat x, GLfloat y, GLfloat z, GLfloat w);
+typedef void (APIENTRYP PFNGLWINDOWPOS4FVMESAPROC) (const GLfloat *v);
+typedef void (APIENTRYP PFNGLWINDOWPOS4IMESAPROC) (GLint x, GLint y, GLint z, GLint w);
+typedef void (APIENTRYP PFNGLWINDOWPOS4SMESAPROC) (GLshort x, GLshort y, GLshort z, GLshort w);
+typedef void (APIENTRYP PFNGLWINDOWPOS4SVMESAPROC) (const GLshort *v);
+#ifndef GL_IBM_cull_vertex
+#define GL_IBM_cull_vertex 1
+#ifndef GL_IBM_multimode_draw_arrays
+#define GL_IBM_multimode_draw_arrays 1
+GLAPI void APIENTRY glMultiModeDrawArraysIBM (const GLenum *, const GLint *, const GLsizei *, GLsizei, GLint);
+GLAPI void APIENTRY glMultiModeDrawElementsIBM (const GLenum *, const GLsizei *, GLenum, const GLvoid* const *, GLsizei, GLint);
+typedef void (APIENTRYP PFNGLMULTIMODEDRAWARRAYSIBMPROC) (const GLenum *mode, const GLint *first, const GLsizei *count, GLsizei primcount, GLint modestride);
+typedef void (APIENTRYP PFNGLMULTIMODEDRAWELEMENTSIBMPROC) (const GLenum *mode, const GLsizei *count, GLenum type, const GLvoid* const *indices, GLsizei primcount, GLint modestride);
+#ifndef GL_IBM_vertex_array_lists
+#define GL_IBM_vertex_array_lists 1
+GLAPI void APIENTRY glColorPointerListIBM (GLint, GLenum, GLint, const GLvoid* *, GLint);
+GLAPI void APIENTRY glSecondaryColorPointerListIBM (GLint, GLenum, GLint, const GLvoid* *, GLint);
+GLAPI void APIENTRY glEdgeFlagPointerListIBM (GLint, const GLboolean* *, GLint);
+GLAPI void APIENTRY glFogCoordPointerListIBM (GLenum, GLint, const GLvoid* *, GLint);
+GLAPI void APIENTRY glIndexPointerListIBM (GLenum, GLint, const GLvoid* *, GLint);
+GLAPI void APIENTRY glNormalPointerListIBM (GLenum, GLint, const GLvoid* *, GLint);
+GLAPI void APIENTRY glTexCoordPointerListIBM (GLint, GLenum, GLint, const GLvoid* *, GLint);
+GLAPI void APIENTRY glVertexPointerListIBM (GLint, GLenum, GLint, const GLvoid* *, GLint);
+typedef void (APIENTRYP PFNGLCOLORPOINTERLISTIBMPROC) (GLint size, GLenum type, GLint stride, const GLvoid* *pointer, GLint ptrstride);
+typedef void (APIENTRYP PFNGLSECONDARYCOLORPOINTERLISTIBMPROC) (GLint size, GLenum type, GLint stride, const GLvoid* *pointer, GLint ptrstride);
+typedef void (APIENTRYP PFNGLEDGEFLAGPOINTERLISTIBMPROC) (GLint stride, const GLboolean* *pointer, GLint ptrstride);
+typedef void (APIENTRYP PFNGLFOGCOORDPOINTERLISTIBMPROC) (GLenum type, GLint stride, const GLvoid* *pointer, GLint ptrstride);
+typedef void (APIENTRYP PFNGLINDEXPOINTERLISTIBMPROC) (GLenum type, GLint stride, const GLvoid* *pointer, GLint ptrstride);
+typedef void (APIENTRYP PFNGLNORMALPOINTERLISTIBMPROC) (GLenum type, GLint stride, const GLvoid* *pointer, GLint ptrstride);
+typedef void (APIENTRYP PFNGLTEXCOORDPOINTERLISTIBMPROC) (GLint size, GLenum type, GLint stride, const GLvoid* *pointer, GLint ptrstride);
+typedef void (APIENTRYP PFNGLVERTEXPOINTERLISTIBMPROC) (GLint size, GLenum type, GLint stride, const GLvoid* *pointer, GLint ptrstride);
+#ifndef GL_SGIX_subsample
+#define GL_SGIX_subsample 1
+#ifndef GL_SGIX_ycrcba
+#define GL_SGIX_ycrcba 1
+#ifndef GL_SGIX_ycrcb_subsample
+#define GL_SGIX_ycrcb_subsample 1
+#ifndef GL_SGIX_depth_pass_instrument
+#define GL_SGIX_depth_pass_instrument 1
+#ifndef GL_3DFX_texture_compression_FXT1
+#define GL_3DFX_texture_compression_FXT1 1
+#ifndef GL_3DFX_multisample
+#define GL_3DFX_multisample 1
+#ifndef GL_3DFX_tbuffer
+#define GL_3DFX_tbuffer 1
+GLAPI void APIENTRY glTbufferMask3DFX (GLuint);
+#ifndef GL_EXT_multisample
+#define GL_EXT_multisample 1
+GLAPI void APIENTRY glSampleMaskEXT (GLclampf, GLboolean);
+GLAPI void APIENTRY glSamplePatternEXT (GLenum);
+typedef void (APIENTRYP PFNGLSAMPLEMASKEXTPROC) (GLclampf value, GLboolean invert);
+#ifndef GL_SGIX_vertex_preclip
+#define GL_SGIX_vertex_preclip 1
+#ifndef GL_SGIX_convolution_accuracy
+#define GL_SGIX_convolution_accuracy 1
+#ifndef GL_SGIX_resample
+#define GL_SGIX_resample 1
+#ifndef GL_SGIS_point_line_texgen
+#define GL_SGIS_point_line_texgen 1
+#ifndef GL_SGIS_texture_color_mask
+#define GL_SGIS_texture_color_mask 1
+GLAPI void APIENTRY glTextureColorMaskSGIS (GLboolean, GLboolean, GLboolean, GLboolean);
+typedef void (APIENTRYP PFNGLTEXTURECOLORMASKSGISPROC) (GLboolean red, GLboolean green, GLboolean blue, GLboolean alpha);
+#ifndef GL_SGIX_igloo_interface
+#define GL_SGIX_igloo_interface 1
+GLAPI void APIENTRY glIglooInterfaceSGIX (GLenum, const GLvoid *);
+typedef void (APIENTRYP PFNGLIGLOOINTERFACESGIXPROC) (GLenum pname, const GLvoid *params);
+#ifndef GL_EXT_texture_env_dot3
+#define GL_EXT_texture_env_dot3 1
+#ifndef GL_ATI_texture_mirror_once
+#define GL_ATI_texture_mirror_once 1
+#ifndef GL_NV_fence
+#define GL_NV_fence 1
+GLAPI void APIENTRY glDeleteFencesNV (GLsizei, const GLuint *);
+GLAPI void APIENTRY glGenFencesNV (GLsizei, GLuint *);
+GLAPI GLboolean APIENTRY glIsFenceNV (GLuint);
+GLAPI GLboolean APIENTRY glTestFenceNV (GLuint);
+GLAPI void APIENTRY glGetFenceivNV (GLuint, GLenum, GLint *);
+GLAPI void APIENTRY glFinishFenceNV (GLuint);
+GLAPI void APIENTRY glSetFenceNV (GLuint, GLenum);
+typedef void (APIENTRYP PFNGLDELETEFENCESNVPROC) (GLsizei n, const GLuint *fences);
+typedef void (APIENTRYP PFNGLGENFENCESNVPROC) (GLsizei n, GLuint *fences);
+typedef GLboolean (APIENTRYP PFNGLISFENCENVPROC) (GLuint fence);
+typedef GLboolean (APIENTRYP PFNGLTESTFENCENVPROC) (GLuint fence);
+typedef void (APIENTRYP PFNGLGETFENCEIVNVPROC) (GLuint fence, GLenum pname, GLint *params);
+typedef void (APIENTRYP PFNGLSETFENCENVPROC) (GLuint fence, GLenum condition);
+#ifndef GL_NV_evaluators
+#define GL_NV_evaluators 1
+GLAPI void APIENTRY glMapControlPointsNV (GLenum, GLuint, GLenum, GLsizei, GLsizei, GLint, GLint, GLboolean, const GLvoid *);
+GLAPI void APIENTRY glMapParameterivNV (GLenum, GLenum, const GLint *);
+GLAPI void APIENTRY glMapParameterfvNV (GLenum, GLenum, const GLfloat *);
+GLAPI void APIENTRY glGetMapControlPointsNV (GLenum, GLuint, GLenum, GLsizei, GLsizei, GLboolean, GLvoid *);
+GLAPI void APIENTRY glGetMapParameterivNV (GLenum, GLenum, GLint *);
+GLAPI void APIENTRY glGetMapParameterfvNV (GLenum, GLenum, GLfloat *);
+GLAPI void APIENTRY glGetMapAttribParameterivNV (GLenum, GLuint, GLenum, GLint *);
+GLAPI void APIENTRY glGetMapAttribParameterfvNV (GLenum, GLuint, GLenum, GLfloat *);
+GLAPI void APIENTRY glEvalMapsNV (GLenum, GLenum);
+typedef void (APIENTRYP PFNGLMAPCONTROLPOINTSNVPROC) (GLenum target, GLuint index, GLenum type, GLsizei ustride, GLsizei vstride, GLint uorder, GLint vorder, GLboolean packed, const GLvoid *points);
+typedef void (APIENTRYP PFNGLMAPPARAMETERIVNVPROC) (GLenum target, GLenum pname, const GLint *params);
+typedef void (APIENTRYP PFNGLMAPPARAMETERFVNVPROC) (GLenum target, GLenum pname, const GLfloat *params);
+typedef void (APIENTRYP PFNGLGETMAPCONTROLPOINTSNVPROC) (GLenum target, GLuint index, GLenum type, GLsizei ustride, GLsizei vstride, GLboolean packed, GLvoid *points);
+typedef void (APIENTRYP PFNGLGETMAPPARAMETERIVNVPROC) (GLenum target, GLenum pname, GLint *params);
+typedef void (APIENTRYP PFNGLGETMAPPARAMETERFVNVPROC) (GLenum target, GLenum pname, GLfloat *params);
+typedef void (APIENTRYP PFNGLGETMAPATTRIBPARAMETERIVNVPROC) (GLenum target, GLuint index, GLenum pname, GLint *params);
+typedef void (APIENTRYP PFNGLGETMAPATTRIBPARAMETERFVNVPROC) (GLenum target, GLuint index, GLenum pname, GLfloat *params);
+typedef void (APIENTRYP PFNGLEVALMAPSNVPROC) (GLenum target, GLenum mode);
+#ifndef GL_NV_packed_depth_stencil
+#define GL_NV_packed_depth_stencil 1
+#ifndef GL_NV_register_combiners2
+#define GL_NV_register_combiners2 1
+GLAPI void APIENTRY glCombinerStageParameterfvNV (GLenum, GLenum, const GLfloat *);
+GLAPI void APIENTRY glGetCombinerStageParameterfvNV (GLenum, GLenum, GLfloat *);
+typedef void (APIENTRYP PFNGLCOMBINERSTAGEPARAMETERFVNVPROC) (GLenum stage, GLenum pname, const GLfloat *params);
+typedef void (APIENTRYP PFNGLGETCOMBINERSTAGEPARAMETERFVNVPROC) (GLenum stage, GLenum pname, GLfloat *params);
+#ifndef GL_NV_texture_compression_vtc
+#define GL_NV_texture_compression_vtc 1
+#ifndef GL_NV_texture_rectangle
+#define GL_NV_texture_rectangle 1
+#ifndef GL_NV_texture_shader
+#define GL_NV_texture_shader 1
+#ifndef GL_NV_texture_shader2
+#define GL_NV_texture_shader2 1
+#ifndef GL_NV_vertex_array_range2
+#define GL_NV_vertex_array_range2 1
+#ifndef GL_NV_vertex_program
+#define GL_NV_vertex_program 1
+GLAPI GLboolean APIENTRY glAreProgramsResidentNV (GLsizei, const GLuint *, GLboolean *);
+GLAPI void APIENTRY glBindProgramNV (GLenum, GLuint);
+GLAPI void APIENTRY glDeleteProgramsNV (GLsizei, const GLuint *);
+GLAPI void APIENTRY glExecuteProgramNV (GLenum, GLuint, const GLfloat *);
+GLAPI void APIENTRY glGenProgramsNV (GLsizei, GLuint *);
+GLAPI void APIENTRY glGetProgramParameterdvNV (GLenum, GLuint, GLenum, GLdouble *);
+GLAPI void APIENTRY glGetProgramParameterfvNV (GLenum, GLuint, GLenum, GLfloat *);
+GLAPI void APIENTRY glGetProgramivNV (GLuint, GLenum, GLint *);
+GLAPI void APIENTRY glGetProgramStringNV (GLuint, GLenum, GLubyte *);
+GLAPI void APIENTRY glGetTrackMatrixivNV (GLenum, GLuint, GLenum, GLint *);
+GLAPI void APIENTRY glGetVertexAttribdvNV (GLuint, GLenum, GLdouble *);
+GLAPI void APIENTRY glGetVertexAttribfvNV (GLuint, GLenum, GLfloat *);
+GLAPI void APIENTRY glGetVertexAttribivNV (GLuint, GLenum, GLint *);
+GLAPI void APIENTRY glGetVertexAttribPointervNV (GLuint, GLenum, GLvoid* *);
+GLAPI GLboolean APIENTRY glIsProgramNV (GLuint);
+GLAPI void APIENTRY glLoadProgramNV (GLenum, GLuint, GLsizei, const GLubyte *);
+GLAPI void APIENTRY glProgramParameter4dNV (GLenum, GLuint, GLdouble, GLdouble, GLdouble, GLdouble);
+GLAPI void APIENTRY glProgramParameter4dvNV (GLenum, GLuint, const GLdouble *);
+GLAPI void APIENTRY glProgramParameter4fNV (GLenum, GLuint, GLfloat, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glProgramParameter4fvNV (GLenum, GLuint, const GLfloat *);
+GLAPI void APIENTRY glProgramParameters4dvNV (GLenum, GLuint, GLuint, const GLdouble *);
+GLAPI void APIENTRY glProgramParameters4fvNV (GLenum, GLuint, GLuint, const GLfloat *);
+GLAPI void APIENTRY glRequestResidentProgramsNV (GLsizei, const GLuint *);
+GLAPI void APIENTRY glTrackMatrixNV (GLenum, GLuint, GLenum, GLenum);
+GLAPI void APIENTRY glVertexAttribPointerNV (GLuint, GLint, GLenum, GLsizei, const GLvoid *);
+GLAPI void APIENTRY glVertexAttrib1dNV (GLuint, GLdouble);
+GLAPI void APIENTRY glVertexAttrib1dvNV (GLuint, const GLdouble *);
+GLAPI void APIENTRY glVertexAttrib1fNV (GLuint, GLfloat);
+GLAPI void APIENTRY glVertexAttrib1fvNV (GLuint, const GLfloat *);
+GLAPI void APIENTRY glVertexAttrib1sNV (GLuint, GLshort);
+GLAPI void APIENTRY glVertexAttrib1svNV (GLuint, const GLshort *);
+GLAPI void APIENTRY glVertexAttrib2dNV (GLuint, GLdouble, GLdouble);
+GLAPI void APIENTRY glVertexAttrib2dvNV (GLuint, const GLdouble *);
+GLAPI void APIENTRY glVertexAttrib2fNV (GLuint, GLfloat, GLfloat);
+GLAPI void APIENTRY glVertexAttrib2fvNV (GLuint, const GLfloat *);
+GLAPI void APIENTRY glVertexAttrib2sNV (GLuint, GLshort, GLshort);
+GLAPI void APIENTRY glVertexAttrib2svNV (GLuint, const GLshort *);
+GLAPI void APIENTRY glVertexAttrib3dNV (GLuint, GLdouble, GLdouble, GLdouble);
+GLAPI void APIENTRY glVertexAttrib3dvNV (GLuint, const GLdouble *);
+GLAPI void APIENTRY glVertexAttrib3fNV (GLuint, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glVertexAttrib3fvNV (GLuint, const GLfloat *);
+GLAPI void APIENTRY glVertexAttrib3sNV (GLuint, GLshort, GLshort, GLshort);
+GLAPI void APIENTRY glVertexAttrib3svNV (GLuint, const GLshort *);
+GLAPI void APIENTRY glVertexAttrib4dNV (GLuint, GLdouble, GLdouble, GLdouble, GLdouble);
+GLAPI void APIENTRY glVertexAttrib4dvNV (GLuint, const GLdouble *);
+GLAPI void APIENTRY glVertexAttrib4fNV (GLuint, GLfloat, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glVertexAttrib4fvNV (GLuint, const GLfloat *);
+GLAPI void APIENTRY glVertexAttrib4sNV (GLuint, GLshort, GLshort, GLshort, GLshort);
+GLAPI void APIENTRY glVertexAttrib4svNV (GLuint, const GLshort *);
+GLAPI void APIENTRY glVertexAttrib4ubNV (GLuint, GLubyte, GLubyte, GLubyte, GLubyte);
+GLAPI void APIENTRY glVertexAttrib4ubvNV (GLuint, const GLubyte *);
+GLAPI void APIENTRY glVertexAttribs1dvNV (GLuint, GLsizei, const GLdouble *);
+GLAPI void APIENTRY glVertexAttribs1fvNV (GLuint, GLsizei, const GLfloat *);
+GLAPI void APIENTRY glVertexAttribs1svNV (GLuint, GLsizei, const GLshort *);
+GLAPI void APIENTRY glVertexAttribs2dvNV (GLuint, GLsizei, const GLdouble *);
+GLAPI void APIENTRY glVertexAttribs2fvNV (GLuint, GLsizei, const GLfloat *);
+GLAPI void APIENTRY glVertexAttribs2svNV (GLuint, GLsizei, const GLshort *);
+GLAPI void APIENTRY glVertexAttribs3dvNV (GLuint, GLsizei, const GLdouble *);
+GLAPI void APIENTRY glVertexAttribs3fvNV (GLuint, GLsizei, const GLfloat *);
+GLAPI void APIENTRY glVertexAttribs3svNV (GLuint, GLsizei, const GLshort *);
+GLAPI void APIENTRY glVertexAttribs4dvNV (GLuint, GLsizei, const GLdouble *);
+GLAPI void APIENTRY glVertexAttribs4fvNV (GLuint, GLsizei, const GLfloat *);
+GLAPI void APIENTRY glVertexAttribs4svNV (GLuint, GLsizei, const GLshort *);
+GLAPI void APIENTRY glVertexAttribs4ubvNV (GLuint, GLsizei, const GLubyte *);
+typedef GLboolean (APIENTRYP PFNGLAREPROGRAMSRESIDENTNVPROC) (GLsizei n, const GLuint *programs, GLboolean *residences);
+typedef void (APIENTRYP PFNGLBINDPROGRAMNVPROC) (GLenum target, GLuint id);
+typedef void (APIENTRYP PFNGLDELETEPROGRAMSNVPROC) (GLsizei n, const GLuint *programs);
+typedef void (APIENTRYP PFNGLEXECUTEPROGRAMNVPROC) (GLenum target, GLuint id, const GLfloat *params);
+typedef void (APIENTRYP PFNGLGENPROGRAMSNVPROC) (GLsizei n, GLuint *programs);
+typedef void (APIENTRYP PFNGLGETPROGRAMPARAMETERDVNVPROC) (GLenum target, GLuint index, GLenum pname, GLdouble *params);
+typedef void (APIENTRYP PFNGLGETPROGRAMPARAMETERFVNVPROC) (GLenum target, GLuint index, GLenum pname, GLfloat *params);
+typedef void (APIENTRYP PFNGLGETPROGRAMIVNVPROC) (GLuint id, GLenum pname, GLint *params);
+typedef void (APIENTRYP PFNGLGETPROGRAMSTRINGNVPROC) (GLuint id, GLenum pname, GLubyte *program);
+typedef void (APIENTRYP PFNGLGETTRACKMATRIXIVNVPROC) (GLenum target, GLuint address, GLenum pname, GLint *params);
+typedef void (APIENTRYP PFNGLGETVERTEXATTRIBDVNVPROC) (GLuint index, GLenum pname, GLdouble *params);
+typedef void (APIENTRYP PFNGLGETVERTEXATTRIBFVNVPROC) (GLuint index, GLenum pname, GLfloat *params);
+typedef void (APIENTRYP PFNGLGETVERTEXATTRIBIVNVPROC) (GLuint index, GLenum pname, GLint *params);
+typedef void (APIENTRYP PFNGLGETVERTEXATTRIBPOINTERVNVPROC) (GLuint index, GLenum pname, GLvoid* *pointer);
+typedef void (APIENTRYP PFNGLLOADPROGRAMNVPROC) (GLenum target, GLuint id, GLsizei len, const GLubyte *program);
+typedef void (APIENTRYP PFNGLPROGRAMPARAMETER4DNVPROC) (GLenum target, GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w);
+typedef void (APIENTRYP PFNGLPROGRAMPARAMETER4DVNVPROC) (GLenum target, GLuint index, const GLdouble *v);
+typedef void (APIENTRYP PFNGLPROGRAMPARAMETER4FNVPROC) (GLenum target, GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w);
+typedef void (APIENTRYP PFNGLPROGRAMPARAMETER4FVNVPROC) (GLenum target, GLuint index, const GLfloat *v);
+typedef void (APIENTRYP PFNGLPROGRAMPARAMETERS4DVNVPROC) (GLenum target, GLuint index, GLuint count, const GLdouble *v);
+typedef void (APIENTRYP PFNGLPROGRAMPARAMETERS4FVNVPROC) (GLenum target, GLuint index, GLuint count, const GLfloat *v);
+typedef void (APIENTRYP PFNGLREQUESTRESIDENTPROGRAMSNVPROC) (GLsizei n, const GLuint *programs);
+typedef void (APIENTRYP PFNGLTRACKMATRIXNVPROC) (GLenum target, GLuint address, GLenum matrix, GLenum transform);
+typedef void (APIENTRYP PFNGLVERTEXATTRIBPOINTERNVPROC) (GLuint index, GLint fsize, GLenum type, GLsizei stride, const GLvoid *pointer);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB1DNVPROC) (GLuint index, GLdouble x);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB1DVNVPROC) (GLuint index, const GLdouble *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB1FNVPROC) (GLuint index, GLfloat x);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB1FVNVPROC) (GLuint index, const GLfloat *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB1SNVPROC) (GLuint index, GLshort x);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB1SVNVPROC) (GLuint index, const GLshort *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB2DNVPROC) (GLuint index, GLdouble x, GLdouble y);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB2DVNVPROC) (GLuint index, const GLdouble *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB2FNVPROC) (GLuint index, GLfloat x, GLfloat y);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB2FVNVPROC) (GLuint index, const GLfloat *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB2SNVPROC) (GLuint index, GLshort x, GLshort y);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB2SVNVPROC) (GLuint index, const GLshort *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB3DNVPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB3DVNVPROC) (GLuint index, const GLdouble *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB3FNVPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat z);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB3FVNVPROC) (GLuint index, const GLfloat *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB3SNVPROC) (GLuint index, GLshort x, GLshort y, GLshort z);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB3SVNVPROC) (GLuint index, const GLshort *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4DNVPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4DVNVPROC) (GLuint index, const GLdouble *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4FNVPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4FVNVPROC) (GLuint index, const GLfloat *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4SNVPROC) (GLuint index, GLshort x, GLshort y, GLshort z, GLshort w);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4SVNVPROC) (GLuint index, const GLshort *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4UBNVPROC) (GLuint index, GLubyte x, GLubyte y, GLubyte z, GLubyte w);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4UBVNVPROC) (GLuint index, const GLubyte *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIBS1DVNVPROC) (GLuint index, GLsizei count, const GLdouble *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIBS1FVNVPROC) (GLuint index, GLsizei count, const GLfloat *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIBS1SVNVPROC) (GLuint index, GLsizei count, const GLshort *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIBS2DVNVPROC) (GLuint index, GLsizei count, const GLdouble *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIBS2FVNVPROC) (GLuint index, GLsizei count, const GLfloat *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIBS2SVNVPROC) (GLuint index, GLsizei count, const GLshort *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIBS3DVNVPROC) (GLuint index, GLsizei count, const GLdouble *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIBS3FVNVPROC) (GLuint index, GLsizei count, const GLfloat *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIBS3SVNVPROC) (GLuint index, GLsizei count, const GLshort *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIBS4DVNVPROC) (GLuint index, GLsizei count, const GLdouble *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIBS4FVNVPROC) (GLuint index, GLsizei count, const GLfloat *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIBS4SVNVPROC) (GLuint index, GLsizei count, const GLshort *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIBS4UBVNVPROC) (GLuint index, GLsizei count, const GLubyte *v);
+#ifndef GL_SGIX_texture_coordinate_clamp
+#define GL_SGIX_texture_coordinate_clamp 1
+#ifndef GL_SGIX_scalebias_hint
+#define GL_SGIX_scalebias_hint 1
+#ifndef GL_OML_interlace
+#define GL_OML_interlace 1
+#ifndef GL_OML_subsample
+#define GL_OML_subsample 1
+#ifndef GL_OML_resample
+#define GL_OML_resample 1
+#ifndef GL_NV_copy_depth_to_color
+#define GL_NV_copy_depth_to_color 1
+#ifndef GL_ATI_envmap_bumpmap
+#define GL_ATI_envmap_bumpmap 1
+GLAPI void APIENTRY glTexBumpParameterivATI (GLenum, const GLint *);
+GLAPI void APIENTRY glTexBumpParameterfvATI (GLenum, const GLfloat *);
+GLAPI void APIENTRY glGetTexBumpParameterivATI (GLenum, GLint *);
+GLAPI void APIENTRY glGetTexBumpParameterfvATI (GLenum, GLfloat *);
+typedef void (APIENTRYP PFNGLTEXBUMPPARAMETERIVATIPROC) (GLenum pname, const GLint *param);
+typedef void (APIENTRYP PFNGLTEXBUMPPARAMETERFVATIPROC) (GLenum pname, const GLfloat *param);
+#ifndef GL_ATI_fragment_shader
+#define GL_ATI_fragment_shader 1
+GLAPI GLuint APIENTRY glGenFragmentShadersATI (GLuint);
+GLAPI void APIENTRY glBindFragmentShaderATI (GLuint);
+GLAPI void APIENTRY glDeleteFragmentShaderATI (GLuint);
+GLAPI void APIENTRY glBeginFragmentShaderATI (void);
+GLAPI void APIENTRY glEndFragmentShaderATI (void);
+GLAPI void APIENTRY glPassTexCoordATI (GLuint, GLuint, GLenum);
+GLAPI void APIENTRY glSampleMapATI (GLuint, GLuint, GLenum);
+GLAPI void APIENTRY glColorFragmentOp1ATI (GLenum, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint);
+GLAPI void APIENTRY glColorFragmentOp2ATI (GLenum, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint);
+GLAPI void APIENTRY glColorFragmentOp3ATI (GLenum, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint);
+GLAPI void APIENTRY glAlphaFragmentOp1ATI (GLenum, GLuint, GLuint, GLuint, GLuint, GLuint);
+GLAPI void APIENTRY glAlphaFragmentOp2ATI (GLenum, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint);
+GLAPI void APIENTRY glAlphaFragmentOp3ATI (GLenum, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint);
+GLAPI void APIENTRY glSetFragmentShaderConstantATI (GLuint, const GLfloat *);
+typedef void (APIENTRYP PFNGLPASSTEXCOORDATIPROC) (GLuint dst, GLuint coord, GLenum swizzle);
+typedef void (APIENTRYP PFNGLSAMPLEMAPATIPROC) (GLuint dst, GLuint interp, GLenum swizzle);
+typedef void (APIENTRYP PFNGLCOLORFRAGMENTOP1ATIPROC) (GLenum op, GLuint dst, GLuint dstMask, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod);
+typedef void (APIENTRYP PFNGLCOLORFRAGMENTOP2ATIPROC) (GLenum op, GLuint dst, GLuint dstMask, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod, GLuint arg2, GLuint arg2Rep, GLuint arg2Mod);
+typedef void (APIENTRYP PFNGLCOLORFRAGMENTOP3ATIPROC) (GLenum op, GLuint dst, GLuint dstMask, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod, GLuint arg2, GLuint arg2Rep, GLuint arg2Mod, GLuint arg3, GLuint arg3Rep, GLuint arg3Mod);
+typedef void (APIENTRYP PFNGLALPHAFRAGMENTOP1ATIPROC) (GLenum op, GLuint dst, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod);
+typedef void (APIENTRYP PFNGLALPHAFRAGMENTOP2ATIPROC) (GLenum op, GLuint dst, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod, GLuint arg2, GLuint arg2Rep, GLuint arg2Mod);
+typedef void (APIENTRYP PFNGLALPHAFRAGMENTOP3ATIPROC) (GLenum op, GLuint dst, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod, GLuint arg2, GLuint arg2Rep, GLuint arg2Mod, GLuint arg3, GLuint arg3Rep, GLuint arg3Mod);
+#ifndef GL_ATI_pn_triangles
+#define GL_ATI_pn_triangles 1
+GLAPI void APIENTRY glPNTrianglesiATI (GLenum, GLint);
+GLAPI void APIENTRY glPNTrianglesfATI (GLenum, GLfloat);
+typedef void (APIENTRYP PFNGLPNTRIANGLESIATIPROC) (GLenum pname, GLint param);
+typedef void (APIENTRYP PFNGLPNTRIANGLESFATIPROC) (GLenum pname, GLfloat param);
+#ifndef GL_ATI_vertex_array_object
+#define GL_ATI_vertex_array_object 1
+GLAPI GLuint APIENTRY glNewObjectBufferATI (GLsizei, const GLvoid *, GLenum);
+GLAPI GLboolean APIENTRY glIsObjectBufferATI (GLuint);
+GLAPI void APIENTRY glUpdateObjectBufferATI (GLuint, GLuint, GLsizei, const GLvoid *, GLenum);
+GLAPI void APIENTRY glGetObjectBufferfvATI (GLuint, GLenum, GLfloat *);
+GLAPI void APIENTRY glGetObjectBufferivATI (GLuint, GLenum, GLint *);
+GLAPI void APIENTRY glFreeObjectBufferATI (GLuint);
+GLAPI void APIENTRY glArrayObjectATI (GLenum, GLint, GLenum, GLsizei, GLuint, GLuint);
+GLAPI void APIENTRY glGetArrayObjectfvATI (GLenum, GLenum, GLfloat *);
+GLAPI void APIENTRY glGetArrayObjectivATI (GLenum, GLenum, GLint *);
+GLAPI void APIENTRY glVariantArrayObjectATI (GLuint, GLenum, GLsizei, GLuint, GLuint);
+GLAPI void APIENTRY glGetVariantArrayObjectfvATI (GLuint, GLenum, GLfloat *);
+GLAPI void APIENTRY glGetVariantArrayObjectivATI (GLuint, GLenum, GLint *);
+typedef GLuint (APIENTRYP PFNGLNEWOBJECTBUFFERATIPROC) (GLsizei size, const GLvoid *pointer, GLenum usage);
+typedef void (APIENTRYP PFNGLUPDATEOBJECTBUFFERATIPROC) (GLuint buffer, GLuint offset, GLsizei size, const GLvoid *pointer, GLenum preserve);
+typedef void (APIENTRYP PFNGLGETOBJECTBUFFERFVATIPROC) (GLuint buffer, GLenum pname, GLfloat *params);
+typedef void (APIENTRYP PFNGLGETOBJECTBUFFERIVATIPROC) (GLuint buffer, GLenum pname, GLint *params);
+typedef void (APIENTRYP PFNGLARRAYOBJECTATIPROC) (GLenum array, GLint size, GLenum type, GLsizei stride, GLuint buffer, GLuint offset);
+typedef void (APIENTRYP PFNGLGETARRAYOBJECTFVATIPROC) (GLenum array, GLenum pname, GLfloat *params);
+typedef void (APIENTRYP PFNGLGETARRAYOBJECTIVATIPROC) (GLenum array, GLenum pname, GLint *params);
+typedef void (APIENTRYP PFNGLVARIANTARRAYOBJECTATIPROC) (GLuint id, GLenum type, GLsizei stride, GLuint buffer, GLuint offset);
+typedef void (APIENTRYP PFNGLGETVARIANTARRAYOBJECTFVATIPROC) (GLuint id, GLenum pname, GLfloat *params);
+typedef void (APIENTRYP PFNGLGETVARIANTARRAYOBJECTIVATIPROC) (GLuint id, GLenum pname, GLint *params);
+#ifndef GL_EXT_vertex_shader
+#define GL_EXT_vertex_shader 1
+GLAPI void APIENTRY glBeginVertexShaderEXT (void);
+GLAPI void APIENTRY glEndVertexShaderEXT (void);
+GLAPI void APIENTRY glBindVertexShaderEXT (GLuint);
+GLAPI GLuint APIENTRY glGenVertexShadersEXT (GLuint);
+GLAPI void APIENTRY glDeleteVertexShaderEXT (GLuint);
+GLAPI void APIENTRY glShaderOp1EXT (GLenum, GLuint, GLuint);
+GLAPI void APIENTRY glShaderOp2EXT (GLenum, GLuint, GLuint, GLuint);
+GLAPI void APIENTRY glShaderOp3EXT (GLenum, GLuint, GLuint, GLuint, GLuint);
+GLAPI void APIENTRY glSwizzleEXT (GLuint, GLuint, GLenum, GLenum, GLenum, GLenum);
+GLAPI void APIENTRY glWriteMaskEXT (GLuint, GLuint, GLenum, GLenum, GLenum, GLenum);
+GLAPI void APIENTRY glInsertComponentEXT (GLuint, GLuint, GLuint);
+GLAPI void APIENTRY glExtractComponentEXT (GLuint, GLuint, GLuint);
+GLAPI GLuint APIENTRY glGenSymbolsEXT (GLenum, GLenum, GLenum, GLuint);
+GLAPI void APIENTRY glSetInvariantEXT (GLuint, GLenum, const GLvoid *);
+GLAPI void APIENTRY glSetLocalConstantEXT (GLuint, GLenum, const GLvoid *);
+GLAPI void APIENTRY glVariantbvEXT (GLuint, const GLbyte *);
+GLAPI void APIENTRY glVariantsvEXT (GLuint, const GLshort *);
+GLAPI void APIENTRY glVariantivEXT (GLuint, const GLint *);
+GLAPI void APIENTRY glVariantfvEXT (GLuint, const GLfloat *);
+GLAPI void APIENTRY glVariantdvEXT (GLuint, const GLdouble *);
+GLAPI void APIENTRY glVariantubvEXT (GLuint, const GLubyte *);
+GLAPI void APIENTRY glVariantusvEXT (GLuint, const GLushort *);
+GLAPI void APIENTRY glVariantuivEXT (GLuint, const GLuint *);
+GLAPI void APIENTRY glVariantPointerEXT (GLuint, GLenum, GLuint, const GLvoid *);
+GLAPI void APIENTRY glEnableVariantClientStateEXT (GLuint);
+GLAPI void APIENTRY glDisableVariantClientStateEXT (GLuint);
+GLAPI GLuint APIENTRY glBindLightParameterEXT (GLenum, GLenum);
+GLAPI GLuint APIENTRY glBindMaterialParameterEXT (GLenum, GLenum);
+GLAPI GLuint APIENTRY glBindTexGenParameterEXT (GLenum, GLenum, GLenum);
+GLAPI GLuint APIENTRY glBindTextureUnitParameterEXT (GLenum, GLenum);
+GLAPI GLuint APIENTRY glBindParameterEXT (GLenum);
+GLAPI GLboolean APIENTRY glIsVariantEnabledEXT (GLuint, GLenum);
+GLAPI void APIENTRY glGetVariantBooleanvEXT (GLuint, GLenum, GLboolean *);
+GLAPI void APIENTRY glGetVariantIntegervEXT (GLuint, GLenum, GLint *);
+GLAPI void APIENTRY glGetVariantFloatvEXT (GLuint, GLenum, GLfloat *);
+GLAPI void APIENTRY glGetVariantPointervEXT (GLuint, GLenum, GLvoid* *);
+GLAPI void APIENTRY glGetInvariantBooleanvEXT (GLuint, GLenum, GLboolean *);
+GLAPI void APIENTRY glGetInvariantIntegervEXT (GLuint, GLenum, GLint *);
+GLAPI void APIENTRY glGetInvariantFloatvEXT (GLuint, GLenum, GLfloat *);
+GLAPI void APIENTRY glGetLocalConstantBooleanvEXT (GLuint, GLenum, GLboolean *);
+GLAPI void APIENTRY glGetLocalConstantIntegervEXT (GLuint, GLenum, GLint *);
+GLAPI void APIENTRY glGetLocalConstantFloatvEXT (GLuint, GLenum, GLfloat *);
+typedef void (APIENTRYP PFNGLSHADEROP1EXTPROC) (GLenum op, GLuint res, GLuint arg1);
+typedef void (APIENTRYP PFNGLSHADEROP2EXTPROC) (GLenum op, GLuint res, GLuint arg1, GLuint arg2);
+typedef void (APIENTRYP PFNGLSHADEROP3EXTPROC) (GLenum op, GLuint res, GLuint arg1, GLuint arg2, GLuint arg3);
+typedef void (APIENTRYP PFNGLSWIZZLEEXTPROC) (GLuint res, GLuint in, GLenum outX, GLenum outY, GLenum outZ, GLenum outW);
+typedef void (APIENTRYP PFNGLWRITEMASKEXTPROC) (GLuint res, GLuint in, GLenum outX, GLenum outY, GLenum outZ, GLenum outW);
+typedef void (APIENTRYP PFNGLINSERTCOMPONENTEXTPROC) (GLuint res, GLuint src, GLuint num);
+typedef void (APIENTRYP PFNGLEXTRACTCOMPONENTEXTPROC) (GLuint res, GLuint src, GLuint num);
+typedef GLuint (APIENTRYP PFNGLGENSYMBOLSEXTPROC) (GLenum datatype, GLenum storagetype, GLenum range, GLuint components);
+typedef void (APIENTRYP PFNGLSETINVARIANTEXTPROC) (GLuint id, GLenum type, const GLvoid *addr);
+typedef void (APIENTRYP PFNGLSETLOCALCONSTANTEXTPROC) (GLuint id, GLenum type, const GLvoid *addr);
+typedef void (APIENTRYP PFNGLVARIANTBVEXTPROC) (GLuint id, const GLbyte *addr);
+typedef void (APIENTRYP PFNGLVARIANTSVEXTPROC) (GLuint id, const GLshort *addr);
+typedef void (APIENTRYP PFNGLVARIANTIVEXTPROC) (GLuint id, const GLint *addr);
+typedef void (APIENTRYP PFNGLVARIANTFVEXTPROC) (GLuint id, const GLfloat *addr);
+typedef void (APIENTRYP PFNGLVARIANTDVEXTPROC) (GLuint id, const GLdouble *addr);
+typedef void (APIENTRYP PFNGLVARIANTUBVEXTPROC) (GLuint id, const GLubyte *addr);
+typedef void (APIENTRYP PFNGLVARIANTUSVEXTPROC) (GLuint id, const GLushort *addr);
+typedef void (APIENTRYP PFNGLVARIANTUIVEXTPROC) (GLuint id, const GLuint *addr);
+typedef void (APIENTRYP PFNGLVARIANTPOINTEREXTPROC) (GLuint id, GLenum type, GLuint stride, const GLvoid *addr);
+typedef GLuint (APIENTRYP PFNGLBINDTEXGENPARAMETEREXTPROC) (GLenum unit, GLenum coord, GLenum value);
+typedef void (APIENTRYP PFNGLGETVARIANTBOOLEANVEXTPROC) (GLuint id, GLenum value, GLboolean *data);
+typedef void (APIENTRYP PFNGLGETVARIANTINTEGERVEXTPROC) (GLuint id, GLenum value, GLint *data);
+typedef void (APIENTRYP PFNGLGETVARIANTFLOATVEXTPROC) (GLuint id, GLenum value, GLfloat *data);
+typedef void (APIENTRYP PFNGLGETVARIANTPOINTERVEXTPROC) (GLuint id, GLenum value, GLvoid* *data);
+typedef void (APIENTRYP PFNGLGETINVARIANTBOOLEANVEXTPROC) (GLuint id, GLenum value, GLboolean *data);
+typedef void (APIENTRYP PFNGLGETINVARIANTINTEGERVEXTPROC) (GLuint id, GLenum value, GLint *data);
+typedef void (APIENTRYP PFNGLGETINVARIANTFLOATVEXTPROC) (GLuint id, GLenum value, GLfloat *data);
+typedef void (APIENTRYP PFNGLGETLOCALCONSTANTBOOLEANVEXTPROC) (GLuint id, GLenum value, GLboolean *data);
+typedef void (APIENTRYP PFNGLGETLOCALCONSTANTINTEGERVEXTPROC) (GLuint id, GLenum value, GLint *data);
+typedef void (APIENTRYP PFNGLGETLOCALCONSTANTFLOATVEXTPROC) (GLuint id, GLenum value, GLfloat *data);
+#ifndef GL_ATI_vertex_streams
+#define GL_ATI_vertex_streams 1
+GLAPI void APIENTRY glVertexStream1sATI (GLenum, GLshort);
+GLAPI void APIENTRY glVertexStream1svATI (GLenum, const GLshort *);
+GLAPI void APIENTRY glVertexStream1iATI (GLenum, GLint);
+GLAPI void APIENTRY glVertexStream1ivATI (GLenum, const GLint *);
+GLAPI void APIENTRY glVertexStream1fATI (GLenum, GLfloat);
+GLAPI void APIENTRY glVertexStream1fvATI (GLenum, const GLfloat *);
+GLAPI void APIENTRY glVertexStream1dATI (GLenum, GLdouble);
+GLAPI void APIENTRY glVertexStream1dvATI (GLenum, const GLdouble *);
+GLAPI void APIENTRY glVertexStream2sATI (GLenum, GLshort, GLshort);
+GLAPI void APIENTRY glVertexStream2svATI (GLenum, const GLshort *);
+GLAPI void APIENTRY glVertexStream2iATI (GLenum, GLint, GLint);
+GLAPI void APIENTRY glVertexStream2ivATI (GLenum, const GLint *);
+GLAPI void APIENTRY glVertexStream2fATI (GLenum, GLfloat, GLfloat);
+GLAPI void APIENTRY glVertexStream2fvATI (GLenum, const GLfloat *);
+GLAPI void APIENTRY glVertexStream2dATI (GLenum, GLdouble, GLdouble);
+GLAPI void APIENTRY glVertexStream2dvATI (GLenum, const GLdouble *);
+GLAPI void APIENTRY glVertexStream3sATI (GLenum, GLshort, GLshort, GLshort);
+GLAPI void APIENTRY glVertexStream3svATI (GLenum, const GLshort *);
+GLAPI void APIENTRY glVertexStream3iATI (GLenum, GLint, GLint, GLint);
+GLAPI void APIENTRY glVertexStream3ivATI (GLenum, const GLint *);
+GLAPI void APIENTRY glVertexStream3fATI (GLenum, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glVertexStream3fvATI (GLenum, const GLfloat *);
+GLAPI void APIENTRY glVertexStream3dATI (GLenum, GLdouble, GLdouble, GLdouble);
+GLAPI void APIENTRY glVertexStream3dvATI (GLenum, const GLdouble *);
+GLAPI void APIENTRY glVertexStream4sATI (GLenum, GLshort, GLshort, GLshort, GLshort);
+GLAPI void APIENTRY glVertexStream4svATI (GLenum, const GLshort *);
+GLAPI void APIENTRY glVertexStream4iATI (GLenum, GLint, GLint, GLint, GLint);
+GLAPI void APIENTRY glVertexStream4ivATI (GLenum, const GLint *);
+GLAPI void APIENTRY glVertexStream4fATI (GLenum, GLfloat, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glVertexStream4fvATI (GLenum, const GLfloat *);
+GLAPI void APIENTRY glVertexStream4dATI (GLenum, GLdouble, GLdouble, GLdouble, GLdouble);
+GLAPI void APIENTRY glVertexStream4dvATI (GLenum, const GLdouble *);
+GLAPI void APIENTRY glNormalStream3bATI (GLenum, GLbyte, GLbyte, GLbyte);
+GLAPI void APIENTRY glNormalStream3bvATI (GLenum, const GLbyte *);
+GLAPI void APIENTRY glNormalStream3sATI (GLenum, GLshort, GLshort, GLshort);
+GLAPI void APIENTRY glNormalStream3svATI (GLenum, const GLshort *);
+GLAPI void APIENTRY glNormalStream3iATI (GLenum, GLint, GLint, GLint);
+GLAPI void APIENTRY glNormalStream3ivATI (GLenum, const GLint *);
+GLAPI void APIENTRY glNormalStream3fATI (GLenum, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glNormalStream3fvATI (GLenum, const GLfloat *);
+GLAPI void APIENTRY glNormalStream3dATI (GLenum, GLdouble, GLdouble, GLdouble);
+GLAPI void APIENTRY glNormalStream3dvATI (GLenum, const GLdouble *);
+GLAPI void APIENTRY glClientActiveVertexStreamATI (GLenum);
+GLAPI void APIENTRY glVertexBlendEnviATI (GLenum, GLint);
+GLAPI void APIENTRY glVertexBlendEnvfATI (GLenum, GLfloat);
+typedef void (APIENTRYP PFNGLVERTEXSTREAM1SATIPROC) (GLenum stream, GLshort x);
+typedef void (APIENTRYP PFNGLVERTEXSTREAM1SVATIPROC) (GLenum stream, const GLshort *coords);
+typedef void (APIENTRYP PFNGLVERTEXSTREAM1IATIPROC) (GLenum stream, GLint x);
+typedef void (APIENTRYP PFNGLVERTEXSTREAM1IVATIPROC) (GLenum stream, const GLint *coords);
+typedef void (APIENTRYP PFNGLVERTEXSTREAM1FATIPROC) (GLenum stream, GLfloat x);
+typedef void (APIENTRYP PFNGLVERTEXSTREAM1FVATIPROC) (GLenum stream, const GLfloat *coords);
+typedef void (APIENTRYP PFNGLVERTEXSTREAM1DATIPROC) (GLenum stream, GLdouble x);
+typedef void (APIENTRYP PFNGLVERTEXSTREAM1DVATIPROC) (GLenum stream, const GLdouble *coords);
+typedef void (APIENTRYP PFNGLVERTEXSTREAM2SATIPROC) (GLenum stream, GLshort x, GLshort y);
+typedef void (APIENTRYP PFNGLVERTEXSTREAM2SVATIPROC) (GLenum stream, const GLshort *coords);
+typedef void (APIENTRYP PFNGLVERTEXSTREAM2IATIPROC) (GLenum stream, GLint x, GLint y);
+typedef void (APIENTRYP PFNGLVERTEXSTREAM2IVATIPROC) (GLenum stream, const GLint *coords);
+typedef void (APIENTRYP PFNGLVERTEXSTREAM2FATIPROC) (GLenum stream, GLfloat x, GLfloat y);
+typedef void (APIENTRYP PFNGLVERTEXSTREAM2FVATIPROC) (GLenum stream, const GLfloat *coords);
+typedef void (APIENTRYP PFNGLVERTEXSTREAM2DATIPROC) (GLenum stream, GLdouble x, GLdouble y);
+typedef void (APIENTRYP PFNGLVERTEXSTREAM2DVATIPROC) (GLenum stream, const GLdouble *coords);
+typedef void (APIENTRYP PFNGLVERTEXSTREAM3SATIPROC) (GLenum stream, GLshort x, GLshort y, GLshort z);
+typedef void (APIENTRYP PFNGLVERTEXSTREAM3SVATIPROC) (GLenum stream, const GLshort *coords);
+typedef void (APIENTRYP PFNGLVERTEXSTREAM3IATIPROC) (GLenum stream, GLint x, GLint y, GLint z);
+typedef void (APIENTRYP PFNGLVERTEXSTREAM3IVATIPROC) (GLenum stream, const GLint *coords);
+typedef void (APIENTRYP PFNGLVERTEXSTREAM3FATIPROC) (GLenum stream, GLfloat x, GLfloat y, GLfloat z);
+typedef void (APIENTRYP PFNGLVERTEXSTREAM3FVATIPROC) (GLenum stream, const GLfloat *coords);
+typedef void (APIENTRYP PFNGLVERTEXSTREAM3DATIPROC) (GLenum stream, GLdouble x, GLdouble y, GLdouble z);
+typedef void (APIENTRYP PFNGLVERTEXSTREAM3DVATIPROC) (GLenum stream, const GLdouble *coords);
+typedef void (APIENTRYP PFNGLVERTEXSTREAM4SATIPROC) (GLenum stream, GLshort x, GLshort y, GLshort z, GLshort w);
+typedef void (APIENTRYP PFNGLVERTEXSTREAM4SVATIPROC) (GLenum stream, const GLshort *coords);
+typedef void (APIENTRYP PFNGLVERTEXSTREAM4IATIPROC) (GLenum stream, GLint x, GLint y, GLint z, GLint w);
+typedef void (APIENTRYP PFNGLVERTEXSTREAM4IVATIPROC) (GLenum stream, const GLint *coords);
+typedef void (APIENTRYP PFNGLVERTEXSTREAM4FATIPROC) (GLenum stream, GLfloat x, GLfloat y, GLfloat z, GLfloat w);
+typedef void (APIENTRYP PFNGLVERTEXSTREAM4FVATIPROC) (GLenum stream, const GLfloat *coords);
+typedef void (APIENTRYP PFNGLVERTEXSTREAM4DATIPROC) (GLenum stream, GLdouble x, GLdouble y, GLdouble z, GLdouble w);
+typedef void (APIENTRYP PFNGLVERTEXSTREAM4DVATIPROC) (GLenum stream, const GLdouble *coords);
+typedef void (APIENTRYP PFNGLNORMALSTREAM3BATIPROC) (GLenum stream, GLbyte nx, GLbyte ny, GLbyte nz);
+typedef void (APIENTRYP PFNGLNORMALSTREAM3BVATIPROC) (GLenum stream, const GLbyte *coords);
+typedef void (APIENTRYP PFNGLNORMALSTREAM3SATIPROC) (GLenum stream, GLshort nx, GLshort ny, GLshort nz);
+typedef void (APIENTRYP PFNGLNORMALSTREAM3SVATIPROC) (GLenum stream, const GLshort *coords);
+typedef void (APIENTRYP PFNGLNORMALSTREAM3IATIPROC) (GLenum stream, GLint nx, GLint ny, GLint nz);
+typedef void (APIENTRYP PFNGLNORMALSTREAM3IVATIPROC) (GLenum stream, const GLint *coords);
+typedef void (APIENTRYP PFNGLNORMALSTREAM3FATIPROC) (GLenum stream, GLfloat nx, GLfloat ny, GLfloat nz);
+typedef void (APIENTRYP PFNGLNORMALSTREAM3FVATIPROC) (GLenum stream, const GLfloat *coords);
+typedef void (APIENTRYP PFNGLNORMALSTREAM3DATIPROC) (GLenum stream, GLdouble nx, GLdouble ny, GLdouble nz);
+typedef void (APIENTRYP PFNGLNORMALSTREAM3DVATIPROC) (GLenum stream, const GLdouble *coords);
+typedef void (APIENTRYP PFNGLVERTEXBLENDENVIATIPROC) (GLenum pname, GLint param);
+typedef void (APIENTRYP PFNGLVERTEXBLENDENVFATIPROC) (GLenum pname, GLfloat param);
+#ifndef GL_ATI_element_array
+#define GL_ATI_element_array 1
+GLAPI void APIENTRY glElementPointerATI (GLenum, const GLvoid *);
+GLAPI void APIENTRY glDrawElementArrayATI (GLenum, GLsizei);
+GLAPI void APIENTRY glDrawRangeElementArrayATI (GLenum, GLuint, GLuint, GLsizei);
+typedef void (APIENTRYP PFNGLELEMENTPOINTERATIPROC) (GLenum type, const GLvoid *pointer);
+typedef void (APIENTRYP PFNGLDRAWELEMENTARRAYATIPROC) (GLenum mode, GLsizei count);
+typedef void (APIENTRYP PFNGLDRAWRANGEELEMENTARRAYATIPROC) (GLenum mode, GLuint start, GLuint end, GLsizei count);
+#ifndef GL_SUN_mesh_array
+#define GL_SUN_mesh_array 1
+GLAPI void APIENTRY glDrawMeshArraysSUN (GLenum, GLint, GLsizei, GLsizei);
+typedef void (APIENTRYP PFNGLDRAWMESHARRAYSSUNPROC) (GLenum mode, GLint first, GLsizei count, GLsizei width);
+#ifndef GL_SUN_slice_accum
+#define GL_SUN_slice_accum 1
+#ifndef GL_NV_multisample_filter_hint
+#define GL_NV_multisample_filter_hint 1
+#ifndef GL_NV_depth_clamp
+#define GL_NV_depth_clamp 1
+#ifndef GL_NV_occlusion_query
+#define GL_NV_occlusion_query 1
+GLAPI void APIENTRY glGenOcclusionQueriesNV (GLsizei, GLuint *);
+GLAPI void APIENTRY glDeleteOcclusionQueriesNV (GLsizei, const GLuint *);
+GLAPI GLboolean APIENTRY glIsOcclusionQueryNV (GLuint);
+GLAPI void APIENTRY glBeginOcclusionQueryNV (GLuint);
+GLAPI void APIENTRY glEndOcclusionQueryNV (void);
+GLAPI void APIENTRY glGetOcclusionQueryivNV (GLuint, GLenum, GLint *);
+GLAPI void APIENTRY glGetOcclusionQueryuivNV (GLuint, GLenum, GLuint *);
+typedef void (APIENTRYP PFNGLGETOCCLUSIONQUERYIVNVPROC) (GLuint id, GLenum pname, GLint *params);
+typedef void (APIENTRYP PFNGLGETOCCLUSIONQUERYUIVNVPROC) (GLuint id, GLenum pname, GLuint *params);
+#ifndef GL_NV_point_sprite
+#define GL_NV_point_sprite 1
+GLAPI void APIENTRY glPointParameteriNV (GLenum, GLint);
+GLAPI void APIENTRY glPointParameterivNV (GLenum, const GLint *);
+typedef void (APIENTRYP PFNGLPOINTPARAMETERINVPROC) (GLenum pname, GLint param);
+typedef void (APIENTRYP PFNGLPOINTPARAMETERIVNVPROC) (GLenum pname, const GLint *params);
+#ifndef GL_NV_texture_shader3
+#define GL_NV_texture_shader3 1
+#ifndef GL_NV_vertex_program1_1
+#define GL_NV_vertex_program1_1 1
+#ifndef GL_EXT_shadow_funcs
+#define GL_EXT_shadow_funcs 1
+#ifndef GL_EXT_stencil_two_side
+#define GL_EXT_stencil_two_side 1
+GLAPI void APIENTRY glActiveStencilFaceEXT (GLenum);
+#ifndef GL_ATI_text_fragment_shader
+#define GL_ATI_text_fragment_shader 1
+#ifndef GL_APPLE_client_storage
+#define GL_APPLE_client_storage 1
+#ifndef GL_APPLE_element_array
+#define GL_APPLE_element_array 1
+GLAPI void APIENTRY glElementPointerAPPLE (GLenum, const GLvoid *);
+GLAPI void APIENTRY glDrawElementArrayAPPLE (GLenum, GLint, GLsizei);
+GLAPI void APIENTRY glDrawRangeElementArrayAPPLE (GLenum, GLuint, GLuint, GLint, GLsizei);
+GLAPI void APIENTRY glMultiDrawElementArrayAPPLE (GLenum, const GLint *, const GLsizei *, GLsizei);
+GLAPI void APIENTRY glMultiDrawRangeElementArrayAPPLE (GLenum, GLuint, GLuint, const GLint *, const GLsizei *, GLsizei);
+typedef void (APIENTRYP PFNGLELEMENTPOINTERAPPLEPROC) (GLenum type, const GLvoid *pointer);
+typedef void (APIENTRYP PFNGLDRAWELEMENTARRAYAPPLEPROC) (GLenum mode, GLint first, GLsizei count);
+typedef void (APIENTRYP PFNGLDRAWRANGEELEMENTARRAYAPPLEPROC) (GLenum mode, GLuint start, GLuint end, GLint first, GLsizei count);
+typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTARRAYAPPLEPROC) (GLenum mode, const GLint *first, const GLsizei *count, GLsizei primcount);
+typedef void (APIENTRYP PFNGLMULTIDRAWRANGEELEMENTARRAYAPPLEPROC) (GLenum mode, GLuint start, GLuint end, const GLint *first, const GLsizei *count, GLsizei primcount);
+#ifndef GL_APPLE_fence
+#define GL_APPLE_fence 1
+GLAPI void APIENTRY glGenFencesAPPLE (GLsizei, GLuint *);
+GLAPI void APIENTRY glDeleteFencesAPPLE (GLsizei, const GLuint *);
+GLAPI void APIENTRY glSetFenceAPPLE (GLuint);
+GLAPI GLboolean APIENTRY glIsFenceAPPLE (GLuint);
+GLAPI GLboolean APIENTRY glTestFenceAPPLE (GLuint);
+GLAPI void APIENTRY glFinishFenceAPPLE (GLuint);
+GLAPI GLboolean APIENTRY glTestObjectAPPLE (GLenum, GLuint);
+GLAPI void APIENTRY glFinishObjectAPPLE (GLenum, GLint);
+typedef void (APIENTRYP PFNGLGENFENCESAPPLEPROC) (GLsizei n, GLuint *fences);
+typedef void (APIENTRYP PFNGLDELETEFENCESAPPLEPROC) (GLsizei n, const GLuint *fences);
+typedef GLboolean (APIENTRYP PFNGLISFENCEAPPLEPROC) (GLuint fence);
+typedef GLboolean (APIENTRYP PFNGLTESTOBJECTAPPLEPROC) (GLenum object, GLuint name);
+typedef void (APIENTRYP PFNGLFINISHOBJECTAPPLEPROC) (GLenum object, GLint name);
+#ifndef GL_APPLE_vertex_array_object
+#define GL_APPLE_vertex_array_object 1
+GLAPI void APIENTRY glBindVertexArrayAPPLE (GLuint);
+GLAPI void APIENTRY glDeleteVertexArraysAPPLE (GLsizei, const GLuint *);
+GLAPI void APIENTRY glGenVertexArraysAPPLE (GLsizei, GLuint *);
+GLAPI GLboolean APIENTRY glIsVertexArrayAPPLE (GLuint);
+typedef void (APIENTRYP PFNGLDELETEVERTEXARRAYSAPPLEPROC) (GLsizei n, const GLuint *arrays);
+typedef void (APIENTRYP PFNGLGENVERTEXARRAYSAPPLEPROC) (GLsizei n, GLuint *arrays);
+#ifndef GL_APPLE_vertex_array_range
+#define GL_APPLE_vertex_array_range 1
+GLAPI void APIENTRY glVertexArrayRangeAPPLE (GLsizei, GLvoid *);
+GLAPI void APIENTRY glFlushVertexArrayRangeAPPLE (GLsizei, GLvoid *);
+GLAPI void APIENTRY glVertexArrayParameteriAPPLE (GLenum, GLint);
+typedef void (APIENTRYP PFNGLVERTEXARRAYRANGEAPPLEPROC) (GLsizei length, GLvoid *pointer);
+typedef void (APIENTRYP PFNGLFLUSHVERTEXARRAYRANGEAPPLEPROC) (GLsizei length, GLvoid *pointer);
+#ifndef GL_APPLE_ycbcr_422
+#define GL_APPLE_ycbcr_422 1
+#ifndef GL_S3_s3tc
+#define GL_S3_s3tc 1
+#ifndef GL_ATI_draw_buffers
+#define GL_ATI_draw_buffers 1
+GLAPI void APIENTRY glDrawBuffersATI (GLsizei, const GLenum *);
+typedef void (APIENTRYP PFNGLDRAWBUFFERSATIPROC) (GLsizei n, const GLenum *bufs);
+#ifndef GL_ATI_pixel_format_float
+#define GL_ATI_pixel_format_float 1
+/* This is really a WGL extension, but defines some associated GL enums.
+ * ATI does not export "GL_ATI_pixel_format_float" in the GL_EXTENSIONS string.
+ */
+#ifndef GL_ATI_texture_env_combine3
+#define GL_ATI_texture_env_combine3 1
+#ifndef GL_ATI_texture_float
+#define GL_ATI_texture_float 1
+#ifndef GL_NV_float_buffer
+#define GL_NV_float_buffer 1
+#ifndef GL_NV_fragment_program
+#define GL_NV_fragment_program 1
+/* Some NV_fragment_program entry points are shared with ARB_vertex_program. */
+GLAPI void APIENTRY glProgramNamedParameter4fNV (GLuint, GLsizei, const GLubyte *, GLfloat, GLfloat, GLfloat, GLfloat);
+GLAPI void APIENTRY glProgramNamedParameter4dNV (GLuint, GLsizei, const GLubyte *, GLdouble, GLdouble, GLdouble, GLdouble);
+GLAPI void APIENTRY glProgramNamedParameter4fvNV (GLuint, GLsizei, const GLubyte *, const GLfloat *);
+GLAPI void APIENTRY glProgramNamedParameter4dvNV (GLuint, GLsizei, const GLubyte *, const GLdouble *);
+GLAPI void APIENTRY glGetProgramNamedParameterfvNV (GLuint, GLsizei, const GLubyte *, GLfloat *);
+GLAPI void APIENTRY glGetProgramNamedParameterdvNV (GLuint, GLsizei, const GLubyte *, GLdouble *);
+typedef void (APIENTRYP PFNGLPROGRAMNAMEDPARAMETER4FNVPROC) (GLuint id, GLsizei len, const GLubyte *name, GLfloat x, GLfloat y, GLfloat z, GLfloat w);
+typedef void (APIENTRYP PFNGLPROGRAMNAMEDPARAMETER4DNVPROC) (GLuint id, GLsizei len, const GLubyte *name, GLdouble x, GLdouble y, GLdouble z, GLdouble w);
+typedef void (APIENTRYP PFNGLPROGRAMNAMEDPARAMETER4FVNVPROC) (GLuint id, GLsizei len, const GLubyte *name, const GLfloat *v);
+typedef void (APIENTRYP PFNGLPROGRAMNAMEDPARAMETER4DVNVPROC) (GLuint id, GLsizei len, const GLubyte *name, const GLdouble *v);
+typedef void (APIENTRYP PFNGLGETPROGRAMNAMEDPARAMETERFVNVPROC) (GLuint id, GLsizei len, const GLubyte *name, GLfloat *params);
+typedef void (APIENTRYP PFNGLGETPROGRAMNAMEDPARAMETERDVNVPROC) (GLuint id, GLsizei len, const GLubyte *name, GLdouble *params);
+#ifndef GL_NV_half_float
+#define GL_NV_half_float 1
+GLAPI void APIENTRY glVertex2hNV (GLhalfNV, GLhalfNV);
+GLAPI void APIENTRY glVertex2hvNV (const GLhalfNV *);
+GLAPI void APIENTRY glVertex3hNV (GLhalfNV, GLhalfNV, GLhalfNV);
+GLAPI void APIENTRY glVertex3hvNV (const GLhalfNV *);
+GLAPI void APIENTRY glVertex4hNV (GLhalfNV, GLhalfNV, GLhalfNV, GLhalfNV);
+GLAPI void APIENTRY glVertex4hvNV (const GLhalfNV *);
+GLAPI void APIENTRY glNormal3hNV (GLhalfNV, GLhalfNV, GLhalfNV);
+GLAPI void APIENTRY glNormal3hvNV (const GLhalfNV *);
+GLAPI void APIENTRY glColor3hNV (GLhalfNV, GLhalfNV, GLhalfNV);
+GLAPI void APIENTRY glColor3hvNV (const GLhalfNV *);
+GLAPI void APIENTRY glColor4hNV (GLhalfNV, GLhalfNV, GLhalfNV, GLhalfNV);
+GLAPI void APIENTRY glColor4hvNV (const GLhalfNV *);
+GLAPI void APIENTRY glTexCoord1hNV (GLhalfNV);
+GLAPI void APIENTRY glTexCoord1hvNV (const GLhalfNV *);
+GLAPI void APIENTRY glTexCoord2hNV (GLhalfNV, GLhalfNV);
+GLAPI void APIENTRY glTexCoord2hvNV (const GLhalfNV *);
+GLAPI void APIENTRY glTexCoord3hNV (GLhalfNV, GLhalfNV, GLhalfNV);
+GLAPI void APIENTRY glTexCoord3hvNV (const GLhalfNV *);
+GLAPI void APIENTRY glTexCoord4hNV (GLhalfNV, GLhalfNV, GLhalfNV, GLhalfNV);
+GLAPI void APIENTRY glTexCoord4hvNV (const GLhalfNV *);
+GLAPI void APIENTRY glMultiTexCoord1hNV (GLenum, GLhalfNV);
+GLAPI void APIENTRY glMultiTexCoord1hvNV (GLenum, const GLhalfNV *);
+GLAPI void APIENTRY glMultiTexCoord2hNV (GLenum, GLhalfNV, GLhalfNV);
+GLAPI void APIENTRY glMultiTexCoord2hvNV (GLenum, const GLhalfNV *);
+GLAPI void APIENTRY glMultiTexCoord3hNV (GLenum, GLhalfNV, GLhalfNV, GLhalfNV);
+GLAPI void APIENTRY glMultiTexCoord3hvNV (GLenum, const GLhalfNV *);
+GLAPI void APIENTRY glMultiTexCoord4hNV (GLenum, GLhalfNV, GLhalfNV, GLhalfNV, GLhalfNV);
+GLAPI void APIENTRY glMultiTexCoord4hvNV (GLenum, const GLhalfNV *);
+GLAPI void APIENTRY glFogCoordhNV (GLhalfNV);
+GLAPI void APIENTRY glFogCoordhvNV (const GLhalfNV *);
+GLAPI void APIENTRY glSecondaryColor3hNV (GLhalfNV, GLhalfNV, GLhalfNV);
+GLAPI void APIENTRY glSecondaryColor3hvNV (const GLhalfNV *);
+GLAPI void APIENTRY glVertexWeighthNV (GLhalfNV);
+GLAPI void APIENTRY glVertexWeighthvNV (const GLhalfNV *);
+GLAPI void APIENTRY glVertexAttrib1hNV (GLuint, GLhalfNV);
+GLAPI void APIENTRY glVertexAttrib1hvNV (GLuint, const GLhalfNV *);
+GLAPI void APIENTRY glVertexAttrib2hNV (GLuint, GLhalfNV, GLhalfNV);
+GLAPI void APIENTRY glVertexAttrib2hvNV (GLuint, const GLhalfNV *);
+GLAPI void APIENTRY glVertexAttrib3hNV (GLuint, GLhalfNV, GLhalfNV, GLhalfNV);
+GLAPI void APIENTRY glVertexAttrib3hvNV (GLuint, const GLhalfNV *);
+GLAPI void APIENTRY glVertexAttrib4hNV (GLuint, GLhalfNV, GLhalfNV, GLhalfNV, GLhalfNV);
+GLAPI void APIENTRY glVertexAttrib4hvNV (GLuint, const GLhalfNV *);
+GLAPI void APIENTRY glVertexAttribs1hvNV (GLuint, GLsizei, const GLhalfNV *);
+GLAPI void APIENTRY glVertexAttribs2hvNV (GLuint, GLsizei, const GLhalfNV *);
+GLAPI void APIENTRY glVertexAttribs3hvNV (GLuint, GLsizei, const GLhalfNV *);
+GLAPI void APIENTRY glVertexAttribs4hvNV (GLuint, GLsizei, const GLhalfNV *);
+typedef void (APIENTRYP PFNGLVERTEX2HNVPROC) (GLhalfNV x, GLhalfNV y);
+typedef void (APIENTRYP PFNGLVERTEX2HVNVPROC) (const GLhalfNV *v);
+typedef void (APIENTRYP PFNGLVERTEX3HNVPROC) (GLhalfNV x, GLhalfNV y, GLhalfNV z);
+typedef void (APIENTRYP PFNGLVERTEX3HVNVPROC) (const GLhalfNV *v);
+typedef void (APIENTRYP PFNGLVERTEX4HNVPROC) (GLhalfNV x, GLhalfNV y, GLhalfNV z, GLhalfNV w);
+typedef void (APIENTRYP PFNGLVERTEX4HVNVPROC) (const GLhalfNV *v);
+typedef void (APIENTRYP PFNGLNORMAL3HNVPROC) (GLhalfNV nx, GLhalfNV ny, GLhalfNV nz);
+typedef void (APIENTRYP PFNGLNORMAL3HVNVPROC) (const GLhalfNV *v);
+typedef void (APIENTRYP PFNGLCOLOR3HNVPROC) (GLhalfNV red, GLhalfNV green, GLhalfNV blue);
+typedef void (APIENTRYP PFNGLCOLOR3HVNVPROC) (const GLhalfNV *v);
+typedef void (APIENTRYP PFNGLCOLOR4HNVPROC) (GLhalfNV red, GLhalfNV green, GLhalfNV blue, GLhalfNV alpha);
+typedef void (APIENTRYP PFNGLCOLOR4HVNVPROC) (const GLhalfNV *v);
+typedef void (APIENTRYP PFNGLTEXCOORD1HVNVPROC) (const GLhalfNV *v);
+typedef void (APIENTRYP PFNGLTEXCOORD2HVNVPROC) (const GLhalfNV *v);
+typedef void (APIENTRYP PFNGLTEXCOORD3HNVPROC) (GLhalfNV s, GLhalfNV t, GLhalfNV r);
+typedef void (APIENTRYP PFNGLTEXCOORD3HVNVPROC) (const GLhalfNV *v);
+typedef void (APIENTRYP PFNGLTEXCOORD4HNVPROC) (GLhalfNV s, GLhalfNV t, GLhalfNV r, GLhalfNV q);
+typedef void (APIENTRYP PFNGLTEXCOORD4HVNVPROC) (const GLhalfNV *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD1HNVPROC) (GLenum target, GLhalfNV s);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD1HVNVPROC) (GLenum target, const GLhalfNV *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD2HNVPROC) (GLenum target, GLhalfNV s, GLhalfNV t);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD2HVNVPROC) (GLenum target, const GLhalfNV *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD3HNVPROC) (GLenum target, GLhalfNV s, GLhalfNV t, GLhalfNV r);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD3HVNVPROC) (GLenum target, const GLhalfNV *v);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD4HNVPROC) (GLenum target, GLhalfNV s, GLhalfNV t, GLhalfNV r, GLhalfNV q);
+typedef void (APIENTRYP PFNGLMULTITEXCOORD4HVNVPROC) (GLenum target, const GLhalfNV *v);
+typedef void (APIENTRYP PFNGLFOGCOORDHVNVPROC) (const GLhalfNV *fog);
+typedef void (APIENTRYP PFNGLSECONDARYCOLOR3HNVPROC) (GLhalfNV red, GLhalfNV green, GLhalfNV blue);
+typedef void (APIENTRYP PFNGLVERTEXWEIGHTHVNVPROC) (const GLhalfNV *weight);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB1HNVPROC) (GLuint index, GLhalfNV x);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB1HVNVPROC) (GLuint index, const GLhalfNV *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB2HNVPROC) (GLuint index, GLhalfNV x, GLhalfNV y);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB2HVNVPROC) (GLuint index, const GLhalfNV *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB3HNVPROC) (GLuint index, GLhalfNV x, GLhalfNV y, GLhalfNV z);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB3HVNVPROC) (GLuint index, const GLhalfNV *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4HNVPROC) (GLuint index, GLhalfNV x, GLhalfNV y, GLhalfNV z, GLhalfNV w);
+typedef void (APIENTRYP PFNGLVERTEXATTRIB4HVNVPROC) (GLuint index, const GLhalfNV *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIBS1HVNVPROC) (GLuint index, GLsizei n, const GLhalfNV *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIBS2HVNVPROC) (GLuint index, GLsizei n, const GLhalfNV *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIBS3HVNVPROC) (GLuint index, GLsizei n, const GLhalfNV *v);
+typedef void (APIENTRYP PFNGLVERTEXATTRIBS4HVNVPROC) (GLuint index, GLsizei n, const GLhalfNV *v);
+#ifndef GL_NV_pixel_data_range
+#define GL_NV_pixel_data_range 1
+GLAPI void APIENTRY glPixelDataRangeNV (GLenum, GLsizei, GLvoid *);
+GLAPI void APIENTRY glFlushPixelDataRangeNV (GLenum);
+typedef void (APIENTRYP PFNGLPIXELDATARANGENVPROC) (GLenum target, GLsizei length, GLvoid *pointer);
+#ifndef GL_NV_primitive_restart
+#define GL_NV_primitive_restart 1
+GLAPI void APIENTRY glPrimitiveRestartNV (void);
+GLAPI void APIENTRY glPrimitiveRestartIndexNV (GLuint);
+#ifndef GL_NV_texture_expand_normal
+#define GL_NV_texture_expand_normal 1
+#ifndef GL_NV_vertex_program2
+#define GL_NV_vertex_program2 1
+#ifndef GL_ATI_map_object_buffer
+#define GL_ATI_map_object_buffer 1
+GLAPI GLvoid* APIENTRY glMapObjectBufferATI (GLuint);
+GLAPI void APIENTRY glUnmapObjectBufferATI (GLuint);
+#ifndef GL_ATI_separate_stencil
+#define GL_ATI_separate_stencil 1
+GLAPI void APIENTRY glStencilOpSeparateATI (GLenum, GLenum, GLenum, GLenum);
+GLAPI void APIENTRY glStencilFuncSeparateATI (GLenum, GLenum, GLint, GLuint);
+typedef void (APIENTRYP PFNGLSTENCILOPSEPARATEATIPROC) (GLenum face, GLenum sfail, GLenum dpfail, GLenum dppass);
+typedef void (APIENTRYP PFNGLSTENCILFUNCSEPARATEATIPROC) (GLenum frontfunc, GLenum backfunc, GLint ref, GLuint mask);
+#ifndef GL_ATI_vertex_attrib_array_object
+#define GL_ATI_vertex_attrib_array_object 1
+GLAPI void APIENTRY glVertexAttribArrayObjectATI (GLuint, GLint, GLenum, GLboolean, GLsizei, GLuint, GLuint);
+GLAPI void APIENTRY glGetVertexAttribArrayObjectfvATI (GLuint, GLenum, GLfloat *);
+GLAPI void APIENTRY glGetVertexAttribArrayObjectivATI (GLuint, GLenum, GLint *);
+typedef void (APIENTRYP PFNGLVERTEXATTRIBARRAYOBJECTATIPROC) (GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride, GLuint buffer, GLuint offset);
+typedef void (APIENTRYP PFNGLGETVERTEXATTRIBARRAYOBJECTFVATIPROC) (GLuint index, GLenum pname, GLfloat *params);
+typedef void (APIENTRYP PFNGLGETVERTEXATTRIBARRAYOBJECTIVATIPROC) (GLuint index, GLenum pname, GLint *params);
+#ifndef GL_OES_read_format
+#define GL_OES_read_format 1
+#ifndef GL_EXT_depth_bounds_test
+#define GL_EXT_depth_bounds_test 1
+GLAPI void APIENTRY glDepthBoundsEXT (GLclampd, GLclampd);
+typedef void (APIENTRYP PFNGLDEPTHBOUNDSEXTPROC) (GLclampd zmin, GLclampd zmax);
+#ifndef GL_EXT_texture_mirror_clamp
+#define GL_EXT_texture_mirror_clamp 1
+#ifndef GL_EXT_blend_equation_separate
+#define GL_EXT_blend_equation_separate 1
+GLAPI void APIENTRY glBlendEquationSeparateEXT (GLenum, GLenum);
+#ifndef GL_MESA_pack_invert
+#define GL_MESA_pack_invert 1
+#ifndef GL_MESA_ycbcr_texture
+#define GL_MESA_ycbcr_texture 1
+#ifndef GL_EXT_pixel_buffer_object
+#define GL_EXT_pixel_buffer_object 1
+#ifndef GL_NV_fragment_program_option
+#define GL_NV_fragment_program_option 1
+#ifndef GL_NV_fragment_program2
+#define GL_NV_fragment_program2 1
+#ifndef GL_NV_vertex_program2_option
+#define GL_NV_vertex_program2_option 1
+#ifndef GL_NV_vertex_program3
+#define GL_NV_vertex_program3 1
+#ifndef GL_EXT_framebuffer_object
+#define GL_EXT_framebuffer_object 1
+GLAPI GLboolean APIENTRY glIsRenderbufferEXT (GLuint);
+GLAPI void APIENTRY glBindRenderbufferEXT (GLenum, GLuint);
+GLAPI void APIENTRY glDeleteRenderbuffersEXT (GLsizei, const GLuint *);
+GLAPI void APIENTRY glGenRenderbuffersEXT (GLsizei, GLuint *);
+GLAPI void APIENTRY glRenderbufferStorageEXT (GLenum, GLenum, GLsizei, GLsizei);
+GLAPI void APIENTRY glGetRenderbufferParameterivEXT (GLenum, GLenum, GLint *);
+GLAPI GLboolean APIENTRY glIsFramebufferEXT (GLuint);
+GLAPI void APIENTRY glBindFramebufferEXT (GLenum, GLuint);
+GLAPI void APIENTRY glDeleteFramebuffersEXT (GLsizei, const GLuint *);
+GLAPI void APIENTRY glGenFramebuffersEXT (GLsizei, GLuint *);
+GLAPI GLenum APIENTRY glCheckFramebufferStatusEXT (GLenum);
+GLAPI void APIENTRY glFramebufferTexture1DEXT (GLenum, GLenum, GLenum, GLuint, GLint);
+GLAPI void APIENTRY glFramebufferTexture2DEXT (GLenum, GLenum, GLenum, GLuint, GLint);
+GLAPI void APIENTRY glFramebufferTexture3DEXT (GLenum, GLenum, GLenum, GLuint, GLint, GLint);
+GLAPI void APIENTRY glFramebufferRenderbufferEXT (GLenum, GLenum, GLenum, GLuint);
+GLAPI void APIENTRY glGetFramebufferAttachmentParameterivEXT (GLenum, GLenum, GLenum, GLint *);
+GLAPI void APIENTRY glGenerateMipmapEXT (GLenum);
+typedef GLboolean (APIENTRYP PFNGLISRENDERBUFFEREXTPROC) (GLuint renderbuffer);
+typedef void (APIENTRYP PFNGLBINDRENDERBUFFEREXTPROC) (GLenum target, GLuint renderbuffer);
+typedef void (APIENTRYP PFNGLDELETERENDERBUFFERSEXTPROC) (GLsizei n, const GLuint *renderbuffers);
+typedef void (APIENTRYP PFNGLGENRENDERBUFFERSEXTPROC) (GLsizei n, GLuint *renderbuffers);
+typedef void (APIENTRYP PFNGLRENDERBUFFERSTORAGEEXTPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height);
+typedef void (APIENTRYP PFNGLGETRENDERBUFFERPARAMETERIVEXTPROC) (GLenum target, GLenum pname, GLint *params);
+typedef GLboolean (APIENTRYP PFNGLISFRAMEBUFFEREXTPROC) (GLuint framebuffer);
+typedef void (APIENTRYP PFNGLBINDFRAMEBUFFEREXTPROC) (GLenum target, GLuint framebuffer);
+typedef void (APIENTRYP PFNGLDELETEFRAMEBUFFERSEXTPROC) (GLsizei n, const GLuint *framebuffers);
+typedef void (APIENTRYP PFNGLGENFRAMEBUFFERSEXTPROC) (GLsizei n, GLuint *framebuffers);
+typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTURE1DEXTPROC) (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level);
+typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTURE2DEXTPROC) (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level);
+typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTURE3DEXTPROC) (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level, GLint zoffset);
+typedef void (APIENTRYP PFNGLFRAMEBUFFERRENDERBUFFEREXTPROC) (GLenum target, GLenum attachment, GLenum renderbuffertarget, GLuint renderbuffer);
+typedef void (APIENTRYP PFNGLGETFRAMEBUFFERATTACHMENTPARAMETERIVEXTPROC) (GLenum target, GLenum attachment, GLenum pname, GLint *params);
+#ifndef GL_GREMEDY_string_marker
+#define GL_GREMEDY_string_marker 1
+GLAPI void APIENTRY glStringMarkerGREMEDY (GLsizei, const GLvoid *);
+typedef void (APIENTRYP PFNGLSTRINGMARKERGREMEDYPROC) (GLsizei len, const GLvoid *string);
+#ifdef __cplusplus
diff --git a/include/GL/glfbdev.h b/include/GL/glfbdev.h
new file mode 100644
index 0000000..4e25e7b
--- /dev/null
+++ b/include/GL/glfbdev.h
@@ -0,0 +1,149 @@
+ * Mesa 3-D graphics library
+ * Version: 6.5
+ *
+ * Copyright (C) 1999-2005 Brian Paul All Rights Reserved.
+ *
+ * Permission is hereby granted, free of charge, to any person obtaining a
+ * copy of this software and associated documentation files (the "Software"),
+ * to deal in the Software without restriction, including without limitation
+ * the rights to use, copy, modify, merge, publish, distribute, sublicense,
+ * and/or sell copies of the Software, and to permit persons to whom the
+ * Software is furnished to do so, subject to the following conditions:
+ *
+ * The above copyright notice and this permission notice shall be included
+ * in all copies or substantial portions of the Software.
+ *
+ */
+#ifndef GLFBDEV_H
+#define GLFBDEV_H
+/* avoid including linux/fb.h */
+struct fb_fix_screeninfo;
+struct fb_var_screeninfo;
+/* public types */
+typedef struct GLFBDevVisualRec *GLFBDevVisualPtr;
+typedef struct GLFBDevBufferRec *GLFBDevBufferPtr;
+typedef struct GLFBDevContextRec *GLFBDevContextPtr;
+/* API version */
+#define GLFBDEV_VERSION_1_0 1
+/* For glFBDevCreateVisual */
+#define GLFBDEV_LEVEL 105
+#define GLFBDEV_NONE 0
+/* For glFBDevGetString */
+#define GLFBDEV_VERSION 200
+#define GLFBDEV_VENDOR 201
+/* Misc functions */
+extern const char *
+glFBDevGetString( int str );
+typedef void (*GLFBDevProc)();
+extern GLFBDevProc
+glFBDevGetProcAddress( const char *procName );
+ * Create a GLFBDevVisual.
+ * \param fixInfo - needed to get the visual types, etc.
+ * \param varInfo - needed to get the bits_per_pixel, etc.
+ * \param attribs - for requesting depth, stencil, accum buffers, etc.
+ */
+extern GLFBDevVisualPtr
+glFBDevCreateVisual( const struct fb_fix_screeninfo *fixInfo,
+ const struct fb_var_screeninfo *varInfo,
+ const int *attribs );
+extern void
+glFBDevDestroyVisual( GLFBDevVisualPtr visual );
+extern int
+glFBDevGetVisualAttrib( const GLFBDevVisualPtr visual, int attrib);
+ * Create a GLFBDevBuffer.
+ * \param fixInfo, varInfo - needed in order to get the screen size
+ * (resolution), etc.
+ * \param visual - as returned by glFBDevCreateVisual()
+ * \param frontBuffer - address of front color buffer
+ * \param backBuffer - address of back color buffer (may be NULL)
+ * \param size - size of the color buffer(s) in bytes.
+ */
+extern GLFBDevBufferPtr
+glFBDevCreateBuffer( const struct fb_fix_screeninfo *fixInfo,
+ const struct fb_var_screeninfo *varInfo,
+ const GLFBDevVisualPtr visual,
+ void *frontBuffer, void *backBuffer, size_t size );
+extern void
+glFBDevDestroyBuffer( GLFBDevBufferPtr buffer );
+extern int
+glFBDevGetBufferAttrib( const GLFBDevBufferPtr buffer, int attrib);
+extern GLFBDevBufferPtr
+glFBDevGetCurrentDrawBuffer( void );
+extern GLFBDevBufferPtr
+glFBDevGetCurrentReadBuffer( void );
+extern void
+glFBDevSwapBuffers( GLFBDevBufferPtr buffer );
+ * Create a GLFBDevContext.
+ * \param visual - as created by glFBDevCreateVisual.
+ * \param share - specifies another context with which to share textures,
+ * display lists, etc. (may be NULL).
+ */
+extern GLFBDevContextPtr
+glFBDevCreateContext( const GLFBDevVisualPtr visual, GLFBDevContextPtr share );
+extern void
+glFBDevDestroyContext( GLFBDevContextPtr context );
+extern int
+glFBDevGetContextAttrib( const GLFBDevContextPtr context, int attrib);
+extern GLFBDevContextPtr
+glFBDevGetCurrentContext( void );
+extern int
+glFBDevMakeCurrent( GLFBDevContextPtr context,
+ GLFBDevBufferPtr drawBuffer,
+ GLFBDevBufferPtr readBuffer );
+#endif /* GLFBDEV_H */
diff --git a/include/GL/glu.h b/include/GL/glu.h
new file mode 100644
index 0000000..c0bac75
--- /dev/null
+++ b/include/GL/glu.h
@@ -0,0 +1,340 @@
+** License Applicability. Except to the extent portions of this file are
+** made subject to an alternative license as permitted in the SGI Free
+** Software License B, Version 1.1 (the "License"), the contents of this
+** file are subject only to the provisions of the License. You may not use
+** this file except in compliance with the License. You may obtain a copy
+** of the License at Silicon Graphics, Inc., attn: Legal Services, 1600
+** Amphitheatre Parkway, Mountain View, CA 94043-1351, or at:
+** Note that, as provided in the License, the Software is distributed on an
+** Original Code. The Original Code is: OpenGL Sample Implementation,
+** Version 1.2.1, released January 26, 2000, developed by Silicon Graphics,
+** Inc. The Original Code is Copyright (c) 1991-2000 Silicon Graphics, Inc.
+** Copyright in any portions created by third parties is as indicated
+** elsewhere herein. All Rights Reserved.
+** Additional Notice Provisions: This software was created using the
+** OpenGL(R) version 1.2.1 Sample Implementation published by SGI, but has
+** not been independently verified as being compliant with the OpenGL(R)
+** version 1.2.1 Specification.
+#ifndef __glu_h__
+#define __glu_h__
+#if defined(USE_MGL_NAMESPACE)
+#include "glu_mangle.h"
+#include <GL/gl.h>
+#ifndef GLAPI
+#define GLAPI
+#ifdef __cplusplus
+extern "C" {
+/* Extensions */
+#define GLU_EXT_object_space_tess 1
+#define GLU_EXT_nurbs_tessellator 1
+/* Boolean */
+#define GLU_FALSE 0
+#define GLU_TRUE 1
+/* Version */
+#define GLU_VERSION_1_1 1
+#define GLU_VERSION_1_2 1
+#define GLU_VERSION_1_3 1
+/* StringName */
+#define GLU_VERSION 100800
+#define GLU_EXTENSIONS 100801
+/* ErrorCode */
+#define GLU_INVALID_ENUM 100900
+#define GLU_INVALID_VALUE 100901
+#define GLU_OUT_OF_MEMORY 100902
+/* NurbsDisplay */
+/* GLU_FILL */
+#define GLU_OUTLINE_POLYGON 100240
+#define GLU_OUTLINE_PATCH 100241
+/* NurbsCallback */
+#define GLU_NURBS_ERROR 100103
+#define GLU_ERROR 100103
+#define GLU_NURBS_BEGIN 100164
+#define GLU_NURBS_BEGIN_EXT 100164
+#define GLU_NURBS_VERTEX 100165
+#define GLU_NURBS_VERTEX_EXT 100165
+#define GLU_NURBS_NORMAL 100166
+#define GLU_NURBS_NORMAL_EXT 100166
+#define GLU_NURBS_COLOR 100167
+#define GLU_NURBS_COLOR_EXT 100167
+#define GLU_NURBS_TEX_COORD_EXT 100168
+#define GLU_NURBS_END 100169
+#define GLU_NURBS_END_EXT 100169
+#define GLU_NURBS_BEGIN_DATA 100170
+#define GLU_NURBS_BEGIN_DATA_EXT 100170
+#define GLU_NURBS_VERTEX_DATA 100171
+#define GLU_NURBS_NORMAL_DATA 100172
+#define GLU_NURBS_COLOR_DATA 100173
+#define GLU_NURBS_COLOR_DATA_EXT 100173
+#define GLU_NURBS_END_DATA 100175
+#define GLU_NURBS_END_DATA_EXT 100175
+/* NurbsError */
+#define GLU_NURBS_ERROR1 100251
+#define GLU_NURBS_ERROR2 100252
+#define GLU_NURBS_ERROR3 100253
+#define GLU_NURBS_ERROR4 100254
+#define GLU_NURBS_ERROR5 100255
+#define GLU_NURBS_ERROR6 100256
+#define GLU_NURBS_ERROR7 100257
+#define GLU_NURBS_ERROR8 100258
+#define GLU_NURBS_ERROR9 100259
+#define GLU_NURBS_ERROR10 100260
+#define GLU_NURBS_ERROR11 100261
+#define GLU_NURBS_ERROR12 100262
+#define GLU_NURBS_ERROR13 100263
+#define GLU_NURBS_ERROR14 100264
+#define GLU_NURBS_ERROR15 100265
+#define GLU_NURBS_ERROR16 100266
+#define GLU_NURBS_ERROR17 100267
+#define GLU_NURBS_ERROR18 100268
+#define GLU_NURBS_ERROR19 100269
+#define GLU_NURBS_ERROR20 100270
+#define GLU_NURBS_ERROR21 100271
+#define GLU_NURBS_ERROR22 100272
+#define GLU_NURBS_ERROR23 100273
+#define GLU_NURBS_ERROR24 100274
+#define GLU_NURBS_ERROR25 100275
+#define GLU_NURBS_ERROR26 100276
+#define GLU_NURBS_ERROR27 100277
+#define GLU_NURBS_ERROR28 100278
+#define GLU_NURBS_ERROR29 100279
+#define GLU_NURBS_ERROR30 100280
+#define GLU_NURBS_ERROR31 100281
+#define GLU_NURBS_ERROR32 100282
+#define GLU_NURBS_ERROR33 100283
+#define GLU_NURBS_ERROR34 100284
+#define GLU_NURBS_ERROR35 100285
+#define GLU_NURBS_ERROR36 100286
+#define GLU_NURBS_ERROR37 100287
+/* NurbsProperty */
+#define GLU_AUTO_LOAD_MATRIX 100200
+#define GLU_CULLING 100201
+#define GLU_DISPLAY_MODE 100204
+#define GLU_SAMPLING_METHOD 100205
+#define GLU_U_STEP 100206
+#define GLU_V_STEP 100207
+#define GLU_NURBS_MODE 100160
+#define GLU_NURBS_MODE_EXT 100160
+#define GLU_NURBS_RENDERER 100162
+#define GLU_NURBS_RENDERER_EXT 100162
+/* NurbsSampling */
+#define GLU_OBJECT_PATH_LENGTH 100209
+#define GLU_PATH_LENGTH 100215
+#define GLU_PARAMETRIC_ERROR 100216
+#define GLU_DOMAIN_DISTANCE 100217
+/* NurbsTrim */
+#define GLU_MAP1_TRIM_2 100210
+#define GLU_MAP1_TRIM_3 100211
+/* QuadricDrawStyle */
+#define GLU_POINT 100010
+#define GLU_LINE 100011
+#define GLU_FILL 100012
+#define GLU_SILHOUETTE 100013
+/* QuadricCallback */
+/* GLU_ERROR */
+/* QuadricNormal */
+#define GLU_SMOOTH 100000
+#define GLU_FLAT 100001
+#define GLU_NONE 100002
+/* QuadricOrientation */
+#define GLU_OUTSIDE 100020
+#define GLU_INSIDE 100021
+/* TessCallback */
+#define GLU_TESS_BEGIN 100100
+#define GLU_BEGIN 100100
+#define GLU_TESS_VERTEX 100101
+#define GLU_VERTEX 100101
+#define GLU_TESS_END 100102
+#define GLU_END 100102
+#define GLU_TESS_ERROR 100103
+#define GLU_TESS_EDGE_FLAG 100104
+#define GLU_EDGE_FLAG 100104
+#define GLU_TESS_COMBINE 100105
+#define GLU_TESS_BEGIN_DATA 100106
+#define GLU_TESS_VERTEX_DATA 100107
+#define GLU_TESS_END_DATA 100108
+#define GLU_TESS_ERROR_DATA 100109
+#define GLU_TESS_EDGE_FLAG_DATA 100110
+#define GLU_TESS_COMBINE_DATA 100111
+/* TessContour */
+#define GLU_CW 100120
+#define GLU_CCW 100121
+#define GLU_INTERIOR 100122
+#define GLU_EXTERIOR 100123
+#define GLU_UNKNOWN 100124
+/* TessProperty */
+#define GLU_TESS_WINDING_RULE 100140
+#define GLU_TESS_BOUNDARY_ONLY 100141
+#define GLU_TESS_TOLERANCE 100142
+/* TessError */
+#define GLU_TESS_ERROR1 100151
+#define GLU_TESS_ERROR2 100152
+#define GLU_TESS_ERROR3 100153
+#define GLU_TESS_ERROR4 100154
+#define GLU_TESS_ERROR5 100155
+#define GLU_TESS_ERROR6 100156
+#define GLU_TESS_ERROR7 100157
+#define GLU_TESS_ERROR8 100158
+#define GLU_TESS_COORD_TOO_LARGE 100155
+/* TessWinding */
+#define GLU_TESS_WINDING_ODD 100130
+#ifdef __cplusplus
+class GLUnurbs;
+class GLUquadric;
+class GLUtesselator;
+typedef struct GLUnurbs GLUnurbs;
+typedef struct GLUquadric GLUquadric;
+typedef struct GLUtesselator GLUtesselator;
+typedef GLUnurbs GLUnurbsObj;
+typedef GLUquadric GLUquadricObj;
+typedef GLUtesselator GLUtesselatorObj;
+typedef GLUtesselator GLUtriangulatorObj;
+#define GLU_TESS_MAX_COORD 1.0e150
+/* Internal convenience typedefs */
+typedef void (GLAPIENTRYP _GLUfuncptr)();
+GLAPI void GLAPIENTRY gluBeginCurve (GLUnurbs* nurb);
+GLAPI void GLAPIENTRY gluBeginPolygon (GLUtesselator* tess);
+GLAPI void GLAPIENTRY gluBeginSurface (GLUnurbs* nurb);
+GLAPI void GLAPIENTRY gluBeginTrim (GLUnurbs* nurb);
+GLAPI GLint GLAPIENTRY gluBuild1DMipmapLevels (GLenum target, GLint internalFormat, GLsizei width, GLenum format, GLenum type, GLint level, GLint base, GLint max, const void *data);
+GLAPI GLint GLAPIENTRY gluBuild1DMipmaps (GLenum target, GLint internalFormat, GLsizei width, GLenum format, GLenum type, const void *data);
+GLAPI GLint GLAPIENTRY gluBuild2DMipmapLevels (GLenum target, GLint internalFormat, GLsizei width, GLsizei height, GLenum format, GLenum type, GLint level, GLint base, GLint max, const void *data);
+GLAPI GLint GLAPIENTRY gluBuild2DMipmaps (GLenum target, GLint internalFormat, GLsizei width, GLsizei height, GLenum format, GLenum type, const void *data);
+GLAPI GLint GLAPIENTRY gluBuild3DMipmapLevels (GLenum target, GLint internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, GLint level, GLint base, GLint max, const void *data);
+GLAPI GLint GLAPIENTRY gluBuild3DMipmaps (GLenum target, GLint internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const void *data);
+GLAPI GLboolean GLAPIENTRY gluCheckExtension (const GLubyte *extName, const GLubyte *extString);
+GLAPI void GLAPIENTRY gluCylinder (GLUquadric* quad, GLdouble base, GLdouble top, GLdouble height, GLint slices, GLint stacks);
+GLAPI void GLAPIENTRY gluDeleteNurbsRenderer (GLUnurbs* nurb);
+GLAPI void GLAPIENTRY gluDeleteQuadric (GLUquadric* quad);
+GLAPI void GLAPIENTRY gluDeleteTess (GLUtesselator* tess);
+GLAPI void GLAPIENTRY gluDisk (GLUquadric* quad, GLdouble inner, GLdouble outer, GLint slices, GLint loops);
+GLAPI void GLAPIENTRY gluEndCurve (GLUnurbs* nurb);
+GLAPI void GLAPIENTRY gluEndPolygon (GLUtesselator* tess);
+GLAPI void GLAPIENTRY gluEndSurface (GLUnurbs* nurb);
+GLAPI void GLAPIENTRY gluEndTrim (GLUnurbs* nurb);
+GLAPI const GLubyte * GLAPIENTRY gluErrorString (GLenum error);
+GLAPI void GLAPIENTRY gluGetNurbsProperty (GLUnurbs* nurb, GLenum property, GLfloat* data);
+GLAPI const GLubyte * GLAPIENTRY gluGetString (GLenum name);
+GLAPI void GLAPIENTRY gluGetTessProperty (GLUtesselator* tess, GLenum which, GLdouble* data);
+GLAPI void GLAPIENTRY gluLoadSamplingMatrices (GLUnurbs* nurb, const GLfloat *model, const GLfloat *perspective, const GLint *view);
+GLAPI void GLAPIENTRY gluLookAt (GLdouble eyeX, GLdouble eyeY, GLdouble eyeZ, GLdouble centerX, GLdouble centerY, GLdouble centerZ, GLdouble upX, GLdouble upY, GLdouble upZ);
+GLAPI GLUnurbs* GLAPIENTRY gluNewNurbsRenderer (void);
+GLAPI GLUquadric* GLAPIENTRY gluNewQuadric (void);
+GLAPI GLUtesselator* GLAPIENTRY gluNewTess (void);
+GLAPI void GLAPIENTRY gluNextContour (GLUtesselator* tess, GLenum type);
+GLAPI void GLAPIENTRY gluNurbsCallback (GLUnurbs* nurb, GLenum which, _GLUfuncptr CallBackFunc);
+GLAPI void GLAPIENTRY gluNurbsCallbackData (GLUnurbs* nurb, GLvoid* userData);
+GLAPI void GLAPIENTRY gluNurbsCallbackDataEXT (GLUnurbs* nurb, GLvoid* userData);
+GLAPI void GLAPIENTRY gluNurbsCurve (GLUnurbs* nurb, GLint knotCount, GLfloat *knots, GLint stride, GLfloat *control, GLint order, GLenum type);
+GLAPI void GLAPIENTRY gluNurbsProperty (GLUnurbs* nurb, GLenum property, GLfloat value);
+GLAPI void GLAPIENTRY gluNurbsSurface (GLUnurbs* nurb, GLint sKnotCount, GLfloat* sKnots, GLint tKnotCount, GLfloat* tKnots, GLint sStride, GLint tStride, GLfloat* control, GLint sOrder, GLint tOrder, GLenum type);
+GLAPI void GLAPIENTRY gluOrtho2D (GLdouble left, GLdouble right, GLdouble bottom, GLdouble top);
+GLAPI void GLAPIENTRY gluPartialDisk (GLUquadric* quad, GLdouble inner, GLdouble outer, GLint slices, GLint loops, GLdouble start, GLdouble sweep);
+GLAPI void GLAPIENTRY gluPerspective (GLdouble fovy, GLdouble aspect, GLdouble zNear, GLdouble zFar);
+GLAPI void GLAPIENTRY gluPickMatrix (GLdouble x, GLdouble y, GLdouble delX, GLdouble delY, GLint *viewport);
+GLAPI GLint GLAPIENTRY gluProject (GLdouble objX, GLdouble objY, GLdouble objZ, const GLdouble *model, const GLdouble *proj, const GLint *view, GLdouble* winX, GLdouble* winY, GLdouble* winZ);
+GLAPI void GLAPIENTRY gluPwlCurve (GLUnurbs* nurb, GLint count, GLfloat* data, GLint stride, GLenum type);
+GLAPI void GLAPIENTRY gluQuadricCallback (GLUquadric* quad, GLenum which, _GLUfuncptr CallBackFunc);
+GLAPI void GLAPIENTRY gluQuadricDrawStyle (GLUquadric* quad, GLenum draw);
+GLAPI void GLAPIENTRY gluQuadricNormals (GLUquadric* quad, GLenum normal);
+GLAPI void GLAPIENTRY gluQuadricOrientation (GLUquadric* quad, GLenum orientation);
+GLAPI void GLAPIENTRY gluQuadricTexture (GLUquadric* quad, GLboolean texture);
+GLAPI GLint GLAPIENTRY gluScaleImage (GLenum format, GLsizei wIn, GLsizei hIn, GLenum typeIn, const void *dataIn, GLsizei wOut, GLsizei hOut, GLenum typeOut, GLvoid* dataOut);
+GLAPI void GLAPIENTRY gluSphere (GLUquadric* quad, GLdouble radius, GLint slices, GLint stacks);
+GLAPI void GLAPIENTRY gluTessBeginContour (GLUtesselator* tess);
+GLAPI void GLAPIENTRY gluTessBeginPolygon (GLUtesselator* tess, GLvoid* data);
+GLAPI void GLAPIENTRY gluTessCallback (GLUtesselator* tess, GLenum which, _GLUfuncptr CallBackFunc);
+GLAPI void GLAPIENTRY gluTessEndContour (GLUtesselator* tess);
+GLAPI void GLAPIENTRY gluTessEndPolygon (GLUtesselator* tess);
+GLAPI void GLAPIENTRY gluTessNormal (GLUtesselator* tess, GLdouble valueX, GLdouble valueY, GLdouble valueZ);
+GLAPI void GLAPIENTRY gluTessProperty (GLUtesselator* tess, GLenum which, GLdouble data);
+GLAPI void GLAPIENTRY gluTessVertex (GLUtesselator* tess, GLdouble *location, GLvoid* data);
+GLAPI GLint GLAPIENTRY gluUnProject (GLdouble winX, GLdouble winY, GLdouble winZ, const GLdouble *model, const GLdouble *proj, const GLint *view, GLdouble* objX, GLdouble* objY, GLdouble* objZ);
+GLAPI GLint GLAPIENTRY gluUnProject4 (GLdouble winX, GLdouble winY, GLdouble winZ, GLdouble clipW, const GLdouble *model, const GLdouble *proj, const GLint *view, GLdouble nearVal, GLdouble farVal, GLdouble* objX, GLdouble* objY, GLdouble* objZ, GLdouble* objW);
+#ifdef __cplusplus
+#endif /* __glu_h__ */
diff --git a/include/GL/glu_mangle.h b/include/GL/glu_mangle.h
new file mode 100644
index 0000000..9c25aa8
--- /dev/null
+++ b/include/GL/glu_mangle.h
@@ -0,0 +1,86 @@
+ * Mesa 3-D graphics library
+ * Version: 3.0
+ * Copyright (C) 1995-1998 Brian Paul
+ *
+ * This library is free software; you can redistribute it and/or
+ * modify it under the terms of the GNU Library General Public
+ * License as published by the Free Software Foundation; either
+ * version 2 of the License, or (at your option) any later version.
+ *
+ * This library is distributed in the hope that it will be useful,
+ * but WITHOUT ANY WARRANTY; without even the implied warranty of
+ * Library General Public License for more details.
+ *
+ * You should have received a copy of the GNU Library General Public
+ * License along with this library; if not, write to the Free
+ * Software Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA.
+ */
+#ifndef GLU_MANGLE_H
+#define GLU_MANGLE_H
+#define gluLookAt mgluLookAt
+#define gluOrtho2D mgluOrtho2D
+#define gluPerspective mgluPerspective
+#define gluPickMatrix mgluPickMatrix
+#define gluProject mgluProject
+#define gluUnProject mgluUnProject
+#define gluErrorString mgluErrorString
+#define gluScaleImage mgluScaleImage
+#define gluBuild1DMipmaps mgluBuild1DMipmaps
+#define gluBuild2DMipmaps mgluBuild2DMipmaps
+#define gluNewQuadric mgluNewQuadric
+#define gluDeleteQuadric mgluDeleteQuadric
+#define gluQuadricDrawStyle mgluQuadricDrawStyle
+#define gluQuadricOrientation mgluQuadricOrientation
+#define gluQuadricNormals mgluQuadricNormals
+#define gluQuadricTexture mgluQuadricTexture
+#define gluQuadricCallback mgluQuadricCallback
+#define gluCylinder mgluCylinder
+#define gluSphere mgluSphere
+#define gluDisk mgluDisk
+#define gluPartialDisk mgluPartialDisk
+#define gluNewNurbsRenderer mgluNewNurbsRenderer
+#define gluDeleteNurbsRenderer mgluDeleteNurbsRenderer
+#define gluLoadSamplingMatrices mgluLoadSamplingMatrices
+#define gluNurbsProperty mgluNurbsProperty
+#define gluGetNurbsProperty mgluGetNurbsProperty
+#define gluBeginCurve mgluBeginCurve
+#define gluEndCurve mgluEndCurve
+#define gluNurbsCurve mgluNurbsCurve
+#define gluBeginSurface mgluBeginSurface
+#define gluEndSurface mgluEndSurface
+#define gluNurbsSurface mgluNurbsSurface
+#define gluBeginTrim mgluBeginTrim
+#define gluEndTrim mgluEndTrim
+#define gluPwlCurve mgluPwlCurve
+#define gluNurbsCallback mgluNurbsCallback
+#define gluNewTess mgluNewTess
+#define gluDeleteTess mgluDeleteTess
+#define gluTessBeginPolygon mgluTessBeginPolygon
+#define gluTessBeginContour mgluTessBeginContour
+#define gluTessVertex mgluTessVertex
+#define gluTessEndPolygon mgluTessEndPolygon
+#define gluTessEndContour mgluTessEndContour
+#define gluTessProperty mgluTessProperty
+#define gluTessNormal mgluTessNormal
+#define gluTessCallback mgluTessCallback
+#define gluGetTessProperty mgluGetTessProperty
+#define gluBeginPolygon mgluBeginPolygon
+#define gluNextContour mgluNextContour
+#define gluEndPolygon mgluEndPolygon
+#define gluGetString mgluGetString
+#define gluBuild1DMipmapLevels mgluBuild1DMipmapLevels
+#define gluBuild2DMipmapLevels mgluBuild2DMipmapLevels
+#define gluBuild3DMipmapLevels mgluBuild3DMipmapLevels
+#define gluBuild3DMipmaps mgluBuild3DMipmaps
+#define gluCheckExtension mgluCheckExtension
+#define gluUnProject4 mgluUnProject4
+#define gluNurbsCallbackData mgluNurbsCallbackData
+#define gluNurbsCallbackDataEXT mgluNurbsCallbackDataEXT
diff --git a/include/GL/glut.h b/include/GL/glut.h
new file mode 100644
index 0000000..23c740e
--- /dev/null
+++ b/include/GL/glut.h
@@ -0,0 +1,748 @@
+#ifndef __glut_h__
+#define __glut_h__
+/* Copyright (c) Mark J. Kilgard, 1994, 1995, 1996, 1998. */
+/* This program is freely distributable without licensing fees and is
+ provided without guarantee or warrantee expressed or implied. This
+ program is -not- in the public domain. */
+#include <GL/gl.h>
+#include <GL/glu.h>
+#ifdef __cplusplus
+extern "C" {
+#if defined(_WIN32)
+/* GLUT 3.7 now tries to avoid including <windows.h>
+ to avoid name space pollution, but Win32's <GL/gl.h>
+ needs APIENTRY and WINGDIAPI defined properly.
+ contributes:
+ If users are building glut code on MS Windows, then they should
+ make sure they include windows.h early, let's not get into a
+ header definitions war since MS has proven it's capability to
+ change header dependencies w/o publishing they have done so.
+ So, let's not include windows.h here, as it's not really required and
+ MS own gl/gl.h *should* include it if the dependency is there. */
+/* To disable automatic library usage for GLUT, define GLUT_NO_LIB_PRAGMA
+ in your compile preprocessor options. */
+# if !defined(GLUT_BUILDING_LIB) && !defined(GLUT_NO_LIB_PRAGMA)
+# pragma comment (lib, "winmm.lib") /* link with Windows MultiMedia lib */
+/* To enable automatic SGI OpenGL for Windows library usage for GLUT,
+ define GLUT_USE_SGI_OPENGL in your compile preprocessor options. */
+# pragma comment (lib, "opengl.lib") /* link with SGI OpenGL for Windows lib */
+# pragma comment (lib, "glu.lib") /* link with SGI OpenGL Utility lib */
+# pragma comment (lib, "glut.lib") /* link with Win32 GLUT for SGI OpenGL lib */
+# else
+# pragma comment (lib, "opengl32.lib") /* link with Microsoft OpenGL lib */
+# pragma comment (lib, "glu32.lib") /* link with Microsoft OpenGL Utility lib */
+# pragma comment (lib, "glut32.lib") /* link with Win32 GLUT lib */
+# endif
+# endif
+/* To disable supression of annoying warnings about floats being promoted
+ to doubles, define GLUT_NO_WARNING_DISABLE in your compile preprocessor
+ options. */
+# pragma warning (disable:4244) /* Disable bogus VC++ 4.2 conversion warnings. */
+# pragma warning (disable:4305) /* VC++ 5.0 version of above warning. */
+# endif
+/* Win32 has an annoying issue where there are multiple C run-time
+ libraries (CRTs). If the executable is linked with a different CRT
+ from the GLUT DLL, the GLUT DLL will not share the same CRT static
+ data seen by the executable. In particular, atexit callbacks registered
+ in the executable will not be called if GLUT calls its (different)
+ exit routine). GLUT is typically built with the
+ "/MD" option (the CRT with multithreading DLL support), but the Visual
+ C++ linker default is "/ML" (the single threaded CRT).
+ One workaround to this issue is requiring users to always link with
+ the same CRT as GLUT is compiled with. That requires users supply a
+ non-standard option. GLUT 3.7 has its own built-in workaround where
+ the executable's "exit" function pointer is covertly passed to GLUT.
+ GLUT then calls the executable's exit function pointer to ensure that
+ any "atexit" calls registered by the application are called if GLUT
+ needs to exit.
+ Note that the __glut*WithExit routines should NEVER be called directly.
+ To avoid the atexit workaround, #define GLUT_DISABLE_ATEXIT_HACK. */
+/* XXX This is from Win32's <process.h> */
+# if !defined(_MSC_VER) && !defined(__MINGW32__) && !defined(__cdecl)
+ /* Define __cdecl for non-Microsoft compilers. */
+# define __cdecl
+# endif
+# ifndef _CRTIMP
+# ifdef _NTSDK
+ /* Definition compatible with NT SDK */
+# define _CRTIMP
+# else
+ /* Current definition */
+# ifdef _DLL
+# define _CRTIMP __declspec(dllimport)
+# else
+# define _CRTIMP
+# endif
+# endif
+# endif
+extern _CRTIMP void __cdecl exit(int);
+# endif
+/* GLUT callback calling convention for Win32. */
+# define GLUTCALLBACK __cdecl
+/* for callback/function pointer defs */
+# define GLUTAPIENTRYV __cdecl
+/* glut-win32 specific macros, defined to prevent collision with
+ and redifinition of Windows system defs, also removes requirement of
+ pretty much any standard windows header from this file */
+#if (_MSC_VER >= 800) || defined(__MINGW32__) || defined(_STDCALL_SUPPORTED) || defined(__CYGWIN32__)
+# define GLUTAPIENTRY __stdcall
+/* GLUT API entry point declarations for Win32. */
+#if defined(GLUT_BUILDING_LIB) && defined(_DLL)
+# define GLUTAPI __declspec(dllexport)
+#elif defined(_DLL)
+# define GLUTAPI __declspec(dllimport)
+# define GLUTAPI extern
+#if defined(_WIN32) && !defined(_WINDEF_) && !defined(MESA)
+# if !defined(MESA_MINWARN)
+# pragma message( "note: WINDOWS.H not included, providing Mesa definition of CALLBACK macro" )
+# pragma message( "----: and PROC typedef. If you receive compiler warnings about either ")
+# pragma message( "----: being multiply defined you should include WINDOWS.H priot to gl/glut.h" )
+# endif
+# define CALLBACK __stdcall
+typedef int (GLUTAPIENTRY *PROC)();
+typedef void *HGLRC;
+typedef void *HDC;
+typedef unsigned long COLORREF;
+#if defined(_WIN32) && !defined(_WINGDI_) && !defined(MESA)
+# if !defined(MESA_MINWARN)
+# pragma message( "note: WINDOWS.H not included, providing Mesa definition of wgl functions" )
+# pragma message( "----: and macros. If you receive compiler warnings about any being multiply ")
+# pragma message( "----: defined you should include WINDOWS.H priot to gl/glut.h" )
+# endif
+# define WGL_FONT_LINES 0
+# ifdef UNICODE
+# define wglUseFontBitmaps wglUseFontBitmapsW
+# define wglUseFontOutlines wglUseFontOutlinesW
+# else
+# define wglUseFontBitmaps wglUseFontBitmapsA
+# define wglUseFontOutlines wglUseFontOutlinesA
+# endif /* !UNICODE */
+# pragma warning( push )
+# pragma warning( disable : 4273 ) /* 'function' : inconsistent DLL linkage. dllexport assumed. */
+# define WGLAPI __declspec(dllimport)
+WGLAPI int GLAPIENTRY wglDeleteContext(HGLRC);
+WGLAPI int GLAPIENTRY wglSwapBuffers(HDC hdc);
+WGLAPI HGLRC GLAPIENTRY wglCreateLayerContext(HDC,int);
+WGLAPI HGLRC GLAPIENTRY wglGetCurrentContext(void);
+WGLAPI PROC GLAPIENTRY wglGetProcAddress(const char*);
+WGLAPI int GLAPIENTRY wglCopyContext(HGLRC, HGLRC, unsigned int);
+WGLAPI int GLAPIENTRY wglDeleteContext(HGLRC);
+WGLAPI int GLAPIENTRY wglDescribeLayerPlane(HDC, int, int, unsigned int,LPLAYERPLANEDESCRIPTOR);
+WGLAPI int GLAPIENTRY wglDescribePixelFormat(HDC,int, unsigned int, LPPIXELFORMATDESCRIPTOR);
+WGLAPI int GLAPIENTRY wglGetLayerPaletteEntries(HDC, int, int, int,COLORREF *);
+WGLAPI int GLAPIENTRY wglGetPixelFormat(HDC hdc);
+WGLAPI int GLAPIENTRY wglRealizeLayerPalette(HDC, int, int);
+WGLAPI int GLAPIENTRY wglSetLayerPaletteEntries(HDC, int, int, int,const COLORREF *);
+WGLAPI int GLAPIENTRY wglSwapLayerBuffers(HDC, unsigned int);
+WGLAPI int GLAPIENTRY wglUseFontBitmapsA(HDC, unsigned long, unsigned long, unsigned long);
+WGLAPI int GLAPIENTRY wglUseFontBitmapsW(HDC, unsigned long, unsigned long, unsigned long);
+WGLAPI int GLAPIENTRY wglUseFontOutlinesA(HDC, unsigned long, unsigned long, unsigned long, float,float, int, LPGLYPHMETRICSFLOAT);
+WGLAPI int GLAPIENTRY wglUseFontOutlinesW(HDC, unsigned long, unsigned long, unsigned long, float,float, int, LPGLYPHMETRICSFLOAT);
+# undef WGLAPI
+# pragma warning( pop )
+#else /* _WIN32 not defined */
+/* Define GLUTAPIENTRY and GLUTCALLBACK to nothing if we aren't on Win32. */
+# define GLUTAPI extern
+ GLUT API revision history:
+ GLUT_API_VERSION is updated to reflect incompatible GLUT
+ API changes (interface changes, semantic changes, deletions,
+ or additions).
+ GLUT_API_VERSION=1 First public release of GLUT. 11/29/94
+ GLUT_API_VERSION=2 Added support for OpenGL/GLX multisampling,
+ extension. Supports new input devices like tablet, dial and button
+ box, and Spaceball. Easy to query OpenGL extensions.
+ GLUT_API_VERSION=3 glutMenuStatus added.
+ GLUT_API_VERSION=4 glutInitDisplayString, glutWarpPointer,
+ glutBitmapLength, glutStrokeLength, glutWindowStatusFunc, dynamic
+ video resize subAPI, glutPostWindowRedisplay, glutKeyboardUpFunc,
+ glutSpecialUpFunc, glutIgnoreKeyRepeat, glutSetKeyRepeat,
+ glutJoystickFunc, glutForceJoystickFunc (NOT FINALIZED!).
+ GLUT_API_VERSION=5 glutGetProcAddress (added by BrianP)
+#ifndef GLUT_API_VERSION /* allow this to be overriden */
+ GLUT implementation revision history:
+ GLUT_XLIB_IMPLEMENTATION is updated to reflect both GLUT
+ API revisions and implementation revisions (ie, bug fixes).
+ GLUT_XLIB_IMPLEMENTATION=1 mjk's first public release of
+ GLUT Xlib-based implementation. 11/29/94
+ GLUT_XLIB_IMPLEMENTATION=2 mjk's second public release of
+ GLUT Xlib-based implementation providing GLUT version 2
+ interfaces.
+ GLUT_XLIB_IMPLEMENTATION=3 mjk's GLUT 2.2 images. 4/17/95
+ GLUT_XLIB_IMPLEMENTATION=4 mjk's GLUT 2.3 images. 6/?/95
+ GLUT_XLIB_IMPLEMENTATION=5 mjk's GLUT 3.0 images. 10/?/95
+ GLUT_XLIB_IMPLEMENTATION=7 mjk's GLUT 3.1+ with glutWarpPoitner. 7/24/96
+ GLUT_XLIB_IMPLEMENTATION=8 mjk's GLUT 3.1+ with glutWarpPoitner
+ and video resize. 1/3/97
+ GLUT_XLIB_IMPLEMENTATION=9 mjk's GLUT 3.4 release with early GLUT 4 routines.
+ GLUT_XLIB_IMPLEMENTATION=11 Mesa 2.5's GLUT 3.6 release.
+ GLUT_XLIB_IMPLEMENTATION=12 mjk's GLUT 3.6 release with early GLUT 4 routines + signal handling.
+ GLUT_XLIB_IMPLEMENTATION=13 mjk's GLUT 3.7 beta with GameGLUT support.
+ GLUT_XLIB_IMPLEMENTATION=14 mjk's GLUT 3.7 beta with f90gl friend interface.
+ GLUT_XLIB_IMPLEMENTATION=15 mjk's GLUT 3.7 beta sync'ed with Mesa <GL/glut.h>
+#ifndef GLUT_XLIB_IMPLEMENTATION /* Allow this to be overriden. */
+/* Display mode bit masks. */
+#define GLUT_RGB 0
+#define GLUT_INDEX 1
+#define GLUT_SINGLE 0
+#define GLUT_DOUBLE 2
+#define GLUT_ACCUM 4
+#define GLUT_ALPHA 8
+#define GLUT_DEPTH 16
+#define GLUT_STENCIL 32
+#if (GLUT_API_VERSION >= 2)
+#define GLUT_STEREO 256
+#if (GLUT_API_VERSION >= 3)
+#define GLUT_LUMINANCE 512
+/* Mouse buttons. */
+/* Mouse button state. */
+#define GLUT_DOWN 0
+#define GLUT_UP 1
+#if (GLUT_API_VERSION >= 2)
+/* function keys */
+#define GLUT_KEY_F1 1
+#define GLUT_KEY_F2 2
+#define GLUT_KEY_F3 3
+#define GLUT_KEY_F4 4
+#define GLUT_KEY_F5 5
+#define GLUT_KEY_F6 6
+#define GLUT_KEY_F7 7
+#define GLUT_KEY_F8 8
+#define GLUT_KEY_F9 9
+#define GLUT_KEY_F10 10
+#define GLUT_KEY_F11 11
+#define GLUT_KEY_F12 12
+/* directional keys */
+#define GLUT_KEY_LEFT 100
+#define GLUT_KEY_UP 101
+#define GLUT_KEY_RIGHT 102
+#define GLUT_KEY_DOWN 103
+#define GLUT_KEY_PAGE_UP 104
+#define GLUT_KEY_PAGE_DOWN 105
+#define GLUT_KEY_HOME 106
+#define GLUT_KEY_END 107
+#define GLUT_KEY_INSERT 108
+/* Entry/exit state. */
+#define GLUT_LEFT 0
+#define GLUT_ENTERED 1
+/* Menu usage state. */
+#define GLUT_MENU_IN_USE 1
+/* Visibility state. */
+#define GLUT_VISIBLE 1
+/* Window status state. */
+#define GLUT_HIDDEN 0
+/* Color index component selection values. */
+#define GLUT_RED 0
+#define GLUT_GREEN 1
+#define GLUT_BLUE 2
+/* Layers for use. */
+#define GLUT_NORMAL 0
+#define GLUT_OVERLAY 1
+#if defined(_WIN32) || defined (GLUT_IMPORT_LIB)
+/* Stroke font constants (use these in GLUT program). */
+#define GLUT_STROKE_ROMAN ((void*)0)
+#define GLUT_STROKE_MONO_ROMAN ((void*)1)
+/* Bitmap font constants (use these in GLUT program). */
+#define GLUT_BITMAP_9_BY_15 ((void*)2)
+#define GLUT_BITMAP_8_BY_13 ((void*)3)
+#define GLUT_BITMAP_TIMES_ROMAN_10 ((void*)4)
+#define GLUT_BITMAP_TIMES_ROMAN_24 ((void*)5)
+#if (GLUT_API_VERSION >= 3)
+#define GLUT_BITMAP_HELVETICA_10 ((void*)6)
+#define GLUT_BITMAP_HELVETICA_12 ((void*)7)
+#define GLUT_BITMAP_HELVETICA_18 ((void*)8)
+/* Stroke font opaque addresses (use constants instead in source code). */
+GLUTAPI void *glutStrokeRoman;
+GLUTAPI void *glutStrokeMonoRoman;
+/* Stroke font constants (use these in GLUT program). */
+#define GLUT_STROKE_ROMAN (&glutStrokeRoman)
+#define GLUT_STROKE_MONO_ROMAN (&glutStrokeMonoRoman)
+/* Bitmap font opaque addresses (use constants instead in source code). */
+GLUTAPI void *glutBitmap9By15;
+GLUTAPI void *glutBitmap8By13;
+GLUTAPI void *glutBitmapTimesRoman10;
+GLUTAPI void *glutBitmapTimesRoman24;
+GLUTAPI void *glutBitmapHelvetica10;
+GLUTAPI void *glutBitmapHelvetica12;
+GLUTAPI void *glutBitmapHelvetica18;
+/* Bitmap font constants (use these in GLUT program). */
+#define GLUT_BITMAP_9_BY_15 (&glutBitmap9By15)
+#define GLUT_BITMAP_8_BY_13 (&glutBitmap8By13)
+#define GLUT_BITMAP_TIMES_ROMAN_10 (&glutBitmapTimesRoman10)
+#define GLUT_BITMAP_TIMES_ROMAN_24 (&glutBitmapTimesRoman24)
+#if (GLUT_API_VERSION >= 3)
+#define GLUT_BITMAP_HELVETICA_10 (&glutBitmapHelvetica10)
+#define GLUT_BITMAP_HELVETICA_12 (&glutBitmapHelvetica12)
+#define GLUT_BITMAP_HELVETICA_18 (&glutBitmapHelvetica18)
+/* glutGet parameters. */
+#define GLUT_WINDOW_X 100
+#define GLUT_WINDOW_Y 101
+#define GLUT_WINDOW_WIDTH 102
+#define GLUT_WINDOW_RGBA 116
+#if (GLUT_API_VERSION >= 2)
+#if (GLUT_API_VERSION >= 3)
+#define GLUT_SCREEN_WIDTH 200
+#define GLUT_MENU_NUM_ITEMS 300
+#define GLUT_INIT_WINDOW_X 500
+#define GLUT_INIT_WINDOW_Y 501
+#if (GLUT_API_VERSION >= 2)
+#define GLUT_ELAPSED_TIME 700
+#if (GLUT_API_VERSION >= 2)
+/* glutDeviceGet parameters. */
+#define GLUT_HAS_KEYBOARD 600
+#define GLUT_HAS_MOUSE 601
+#define GLUT_HAS_TABLET 604
+#define GLUT_NUM_DIALS 608
+#define GLUT_HAS_JOYSTICK 612
+#if (GLUT_API_VERSION >= 3)
+/* glutLayerGet parameters. */
+#define GLUT_LAYER_IN_USE 801
+#define GLUT_HAS_OVERLAY 802
+/* glutVideoResizeGet parameters. */
+#define GLUT_VIDEO_RESIZE_X 906
+#define GLUT_VIDEO_RESIZE_Y 907
+/* glutUseLayer parameters. */
+#define GLUT_NORMAL 0
+#define GLUT_OVERLAY 1
+/* glutGetModifiers return mask. */
+#define GLUT_ACTIVE_ALT 4
+/* glutSetCursor parameters. */
+/* Basic arrows. */
+/* Symbolic cursor shapes. */
+/* Directional cursors. */
+/* Sizing cursors. */
+/* Inherit from parent window. */
+/* Blank cursor. */
+#define GLUT_CURSOR_NONE 101
+/* Fullscreen crosshair (if available). */
+/* GLUT initialization sub-API. */
+GLUTAPI void GLUTAPIENTRY glutInit(int *argcp, char **argv);
+#if defined(_WIN32) && !defined(GLUT_DISABLE_ATEXIT_HACK)
+GLUTAPI void GLUTAPIENTRY __glutInitWithExit(int *argcp, char **argv, void (__cdecl *exitfunc)(int));
+static void GLUTAPIENTRY glutInit_ATEXIT_HACK(int *argcp, char **argv) { __glutInitWithExit(argcp, argv, exit); }
+#define glutInit glutInit_ATEXIT_HACK
+GLUTAPI void GLUTAPIENTRY glutInitDisplayMode(unsigned int mode);
+GLUTAPI void GLUTAPIENTRY glutInitDisplayString(const char *string);
+GLUTAPI void GLUTAPIENTRY glutInitWindowPosition(int x, int y);
+GLUTAPI void GLUTAPIENTRY glutInitWindowSize(int width, int height);
+GLUTAPI void GLUTAPIENTRY glutMainLoop(void);
+/* GLUT window sub-API. */
+GLUTAPI int GLUTAPIENTRY glutCreateWindow(const char *title);
+#if defined(_WIN32) && !defined(GLUT_DISABLE_ATEXIT_HACK)
+GLUTAPI int GLUTAPIENTRY __glutCreateWindowWithExit(const char *title, void (__cdecl *exitfunc)(int));
+static int GLUTAPIENTRY glutCreateWindow_ATEXIT_HACK(const char *title) { return __glutCreateWindowWithExit(title, exit); }
+#define glutCreateWindow glutCreateWindow_ATEXIT_HACK
+GLUTAPI int GLUTAPIENTRY glutCreateSubWindow(int win, int x, int y, int width, int height);
+GLUTAPI void GLUTAPIENTRY glutDestroyWindow(int win);
+GLUTAPI void GLUTAPIENTRY glutPostRedisplay(void);
+GLUTAPI void GLUTAPIENTRY glutPostWindowRedisplay(int win);
+GLUTAPI void GLUTAPIENTRY glutSwapBuffers(void);
+GLUTAPI int GLUTAPIENTRY glutGetWindow(void);
+GLUTAPI void GLUTAPIENTRY glutSetWindow(int win);
+GLUTAPI void GLUTAPIENTRY glutSetWindowTitle(const char *title);
+GLUTAPI void GLUTAPIENTRY glutSetIconTitle(const char *title);
+GLUTAPI void GLUTAPIENTRY glutPositionWindow(int x, int y);
+GLUTAPI void GLUTAPIENTRY glutReshapeWindow(int width, int height);
+GLUTAPI void GLUTAPIENTRY glutPopWindow(void);
+GLUTAPI void GLUTAPIENTRY glutPushWindow(void);
+GLUTAPI void GLUTAPIENTRY glutIconifyWindow(void);
+GLUTAPI void GLUTAPIENTRY glutShowWindow(void);
+GLUTAPI void GLUTAPIENTRY glutHideWindow(void);
+#if (GLUT_API_VERSION >= 3)
+GLUTAPI void GLUTAPIENTRY glutFullScreen(void);
+GLUTAPI void GLUTAPIENTRY glutSetCursor(int cursor);
+GLUTAPI void GLUTAPIENTRY glutWarpPointer(int x, int y);
+/* GLUT overlay sub-API. */
+GLUTAPI void GLUTAPIENTRY glutEstablishOverlay(void);
+GLUTAPI void GLUTAPIENTRY glutRemoveOverlay(void);
+GLUTAPI void GLUTAPIENTRY glutUseLayer(GLenum layer);
+GLUTAPI void GLUTAPIENTRY glutPostOverlayRedisplay(void);
+GLUTAPI void GLUTAPIENTRY glutPostWindowOverlayRedisplay(int win);
+GLUTAPI void GLUTAPIENTRY glutShowOverlay(void);
+GLUTAPI void GLUTAPIENTRY glutHideOverlay(void);
+/* GLUT menu sub-API. */
+GLUTAPI int GLUTAPIENTRY glutCreateMenu(void (GLUTCALLBACK *func)(int));
+#if defined(_WIN32) && !defined(GLUT_DISABLE_ATEXIT_HACK)
+GLUTAPI int GLUTAPIENTRY __glutCreateMenuWithExit(void (GLUTCALLBACK *func)(int), void (__cdecl *exitfunc)(int));
+static int GLUTAPIENTRY glutCreateMenu_ATEXIT_HACK(void (GLUTCALLBACK *func)(int)) { return __glutCreateMenuWithExit(func, exit); }
+#define glutCreateMenu glutCreateMenu_ATEXIT_HACK
+GLUTAPI void GLUTAPIENTRY glutDestroyMenu(int menu);
+GLUTAPI int GLUTAPIENTRY glutGetMenu(void);
+GLUTAPI void GLUTAPIENTRY glutSetMenu(int menu);
+GLUTAPI void GLUTAPIENTRY glutAddMenuEntry(const char *label, int value);
+GLUTAPI void GLUTAPIENTRY glutAddSubMenu(const char *label, int submenu);
+GLUTAPI void GLUTAPIENTRY glutChangeToMenuEntry(int item, const char *label, int value);
+GLUTAPI void GLUTAPIENTRY glutChangeToSubMenu(int item, const char *label, int submenu);
+GLUTAPI void GLUTAPIENTRY glutRemoveMenuItem(int item);
+GLUTAPI void GLUTAPIENTRY glutAttachMenu(int button);
+GLUTAPI void GLUTAPIENTRY glutDetachMenu(int button);
+/* GLUT window callback sub-API. */
+GLUTAPI void GLUTAPIENTRY glutDisplayFunc(void (GLUTCALLBACK *func)(void));
+GLUTAPI void GLUTAPIENTRY glutReshapeFunc(void (GLUTCALLBACK *func)(int width, int height));
+GLUTAPI void GLUTAPIENTRY glutKeyboardFunc(void (GLUTCALLBACK *func)(unsigned char key, int x, int y));
+GLUTAPI void GLUTAPIENTRY glutMouseFunc(void (GLUTCALLBACK *func)(int button, int state, int x, int y));
+GLUTAPI void GLUTAPIENTRY glutMotionFunc(void (GLUTCALLBACK *func)(int x, int y));
+GLUTAPI void GLUTAPIENTRY glutPassiveMotionFunc(void (GLUTCALLBACK *func)(int x, int y));
+GLUTAPI void GLUTAPIENTRY glutEntryFunc(void (GLUTCALLBACK *func)(int state));
+GLUTAPI void GLUTAPIENTRY glutVisibilityFunc(void (GLUTCALLBACK *func)(int state));
+GLUTAPI void GLUTAPIENTRY glutIdleFunc(void (GLUTCALLBACK *func)(void));
+GLUTAPI void GLUTAPIENTRY glutTimerFunc(unsigned int millis, void (GLUTCALLBACK *func)(int value), int value);
+GLUTAPI void GLUTAPIENTRY glutMenuStateFunc(void (GLUTCALLBACK *func)(int state));
+#if (GLUT_API_VERSION >= 2)
+GLUTAPI void GLUTAPIENTRY glutSpecialFunc(void (GLUTCALLBACK *func)(int key, int x, int y));
+GLUTAPI void GLUTAPIENTRY glutSpaceballMotionFunc(void (GLUTCALLBACK *func)(int x, int y, int z));
+GLUTAPI void GLUTAPIENTRY glutSpaceballRotateFunc(void (GLUTCALLBACK *func)(int x, int y, int z));
+GLUTAPI void GLUTAPIENTRY glutSpaceballButtonFunc(void (GLUTCALLBACK *func)(int button, int state));
+GLUTAPI void GLUTAPIENTRY glutButtonBoxFunc(void (GLUTCALLBACK *func)(int button, int state));
+GLUTAPI void GLUTAPIENTRY glutDialsFunc(void (GLUTCALLBACK *func)(int dial, int value));
+GLUTAPI void GLUTAPIENTRY glutTabletMotionFunc(void (GLUTCALLBACK *func)(int x, int y));
+GLUTAPI void GLUTAPIENTRY glutTabletButtonFunc(void (GLUTCALLBACK *func)(int button, int state, int x, int y));
+#if (GLUT_API_VERSION >= 3)
+GLUTAPI void GLUTAPIENTRY glutMenuStatusFunc(void (GLUTCALLBACK *func)(int status, int x, int y));
+GLUTAPI void GLUTAPIENTRY glutOverlayDisplayFunc(void (GLUTCALLBACK *func)(void));
+GLUTAPI void GLUTAPIENTRY glutWindowStatusFunc(void (GLUTCALLBACK *func)(int state));
+GLUTAPI void GLUTAPIENTRY glutKeyboardUpFunc(void (GLUTCALLBACK *func)(unsigned char key, int x, int y));
+GLUTAPI void GLUTAPIENTRY glutSpecialUpFunc(void (GLUTCALLBACK *func)(int key, int x, int y));
+GLUTAPI void GLUTAPIENTRY glutJoystickFunc(void (GLUTCALLBACK *func)(unsigned int buttonMask, int x, int y, int z), int pollInterval);
+/* GLUT color index sub-API. */
+GLUTAPI void GLUTAPIENTRY glutSetColor(int ndx, GLfloat red, GLfloat green, GLfloat blue);
+GLUTAPI GLfloat GLUTAPIENTRY glutGetColor(int ndx, int component);
+GLUTAPI void GLUTAPIENTRY glutCopyColormap(int win);
+/* GLUT state retrieval sub-API. */
+GLUTAPI int GLUTAPIENTRY glutGet(GLenum type);
+GLUTAPI int GLUTAPIENTRY glutDeviceGet(GLenum type);
+#if (GLUT_API_VERSION >= 2)
+/* GLUT extension support sub-API */
+GLUTAPI int GLUTAPIENTRY glutExtensionSupported(const char *name);
+#if (GLUT_API_VERSION >= 3)
+GLUTAPI int GLUTAPIENTRY glutGetModifiers(void);
+GLUTAPI int GLUTAPIENTRY glutLayerGet(GLenum type);
+#if (GLUT_API_VERSION >= 5)
+typedef void (*GLUTproc)();
+GLUTAPI GLUTproc GLUTAPIENTRY glutGetProcAddress(const char *procName);
+/* GLUT font sub-API */
+GLUTAPI void GLUTAPIENTRY glutBitmapCharacter(void *font, int character);
+GLUTAPI int GLUTAPIENTRY glutBitmapWidth(void *font, int character);
+GLUTAPI void GLUTAPIENTRY glutStrokeCharacter(void *font, int character);
+GLUTAPI int GLUTAPIENTRY glutStrokeWidth(void *font, int character);
+GLUTAPI int GLUTAPIENTRY glutBitmapLength(void *font, const unsigned char *string);
+GLUTAPI int GLUTAPIENTRY glutStrokeLength(void *font, const unsigned char *string);
+/* GLUT pre-built models sub-API */
+GLUTAPI void GLUTAPIENTRY glutWireSphere(GLdouble radius, GLint slices, GLint stacks);
+GLUTAPI void GLUTAPIENTRY glutSolidSphere(GLdouble radius, GLint slices, GLint stacks);
+GLUTAPI void GLUTAPIENTRY glutWireCone(GLdouble base, GLdouble height, GLint slices, GLint stacks);
+GLUTAPI void GLUTAPIENTRY glutSolidCone(GLdouble base, GLdouble height, GLint slices, GLint stacks);
+GLUTAPI void GLUTAPIENTRY glutWireCube(GLdouble size);
+GLUTAPI void GLUTAPIENTRY glutSolidCube(GLdouble size);
+GLUTAPI void GLUTAPIENTRY glutWireTorus(GLdouble innerRadius, GLdouble outerRadius, GLint sides, GLint rings);
+GLUTAPI void GLUTAPIENTRY glutSolidTorus(GLdouble innerRadius, GLdouble outerRadius, GLint sides, GLint rings);
+GLUTAPI void GLUTAPIENTRY glutWireDodecahedron(void);
+GLUTAPI void GLUTAPIENTRY glutSolidDodecahedron(void);
+GLUTAPI void GLUTAPIENTRY glutWireTeapot(GLdouble size);
+GLUTAPI void GLUTAPIENTRY glutSolidTeapot(GLdouble size);
+GLUTAPI void GLUTAPIENTRY glutWireOctahedron(void);
+GLUTAPI void GLUTAPIENTRY glutSolidOctahedron(void);
+GLUTAPI void GLUTAPIENTRY glutWireTetrahedron(void);
+GLUTAPI void GLUTAPIENTRY glutSolidTetrahedron(void);
+GLUTAPI void GLUTAPIENTRY glutWireIcosahedron(void);
+GLUTAPI void GLUTAPIENTRY glutSolidIcosahedron(void);
+/* GLUT video resize sub-API. */
+GLUTAPI int GLUTAPIENTRY glutVideoResizeGet(GLenum param);
+GLUTAPI void GLUTAPIENTRY glutSetupVideoResizing(void);
+GLUTAPI void GLUTAPIENTRY glutStopVideoResizing(void);
+GLUTAPI void GLUTAPIENTRY glutVideoResize(int x, int y, int width, int height);
+GLUTAPI void GLUTAPIENTRY glutVideoPan(int x, int y, int width, int height);
+/* GLUT debugging sub-API. */
+GLUTAPI void GLUTAPIENTRY glutReportErrors(void);
+/* GLUT device control sub-API. */
+/* glutSetKeyRepeat modes. */
+/* Joystick button masks. */
+GLUTAPI void GLUTAPIENTRY glutIgnoreKeyRepeat(int ignore);
+GLUTAPI void GLUTAPIENTRY glutSetKeyRepeat(int repeatMode);
+GLUTAPI void GLUTAPIENTRY glutForceJoystickFunc(void);
+/* GLUT game mode sub-API. */
+/* glutGameModeGet. */
+GLUTAPI void GLUTAPIENTRY glutGameModeString(const char *string);
+GLUTAPI int GLUTAPIENTRY glutEnterGameMode(void);
+GLUTAPI void GLUTAPIENTRY glutLeaveGameMode(void);
+GLUTAPI int GLUTAPIENTRY glutGameModeGet(GLenum mode);
+#ifdef __cplusplus
+#endif /* __glut_h__ */
diff --git a/include/GL/glut_h.dja b/include/GL/glut_h.dja
new file mode 100644
index 0000000..e76dcb9
--- /dev/null
+++ b/include/GL/glut_h.dja
@@ -0,0 +1,340 @@
+ * Mesa 3-D graphics library
+ * Version: 3.1
+ * Copyright (C) 1995-1998 Brian Paul
+ *
+ * This library is free software; you can redistribute it and/or
+ * modify it under the terms of the GNU Library General Public
+ * License as published by the Free Software Foundation; either
+ * version 2 of the License, or (at your option) any later version.
+ *
+ * This library is distributed in the hope that it will be useful,
+ * but WITHOUT ANY WARRANTY; without even the implied warranty of
+ * Library General Public License for more details.
+ *
+ * You should have received a copy of the GNU Library General Public
+ * License along with this library; if not, write to the Free
+ * Software Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA.
+ */
+ * This header file is based on the REAL glut.h by Mark J. Kilgard.
+ *
+ * The DJGPP/ALLEGRO (DJA) GLUT implementation was written by
+ * Bernhard Tschirren ( for the sole purpose
+ * of compiling all the sample programs (which use GLUT). Therefore,
+ * is NOT AT ALL a complete version of GLUT!
+ */
+#ifndef __AGLUT_H__
+#define __AGLUT_H__
+#include <GL/gl.h>
+#include <GL/glu.h>
+#define APIENTRY
+#define GLUTAPI extern
+#define GLUT_RGB 0
+#define GLUT_INDEX 1
+#define GLUT_SINGLE 0
+#define GLUT_DOUBLE 2
+#define GLUT_ACCUM 4
+#define GLUT_ALPHA 8
+#define GLUT_DEPTH 16
+#define GLUT_STENCIL 32
+/* Mouse buttons. */
+/* Mouse button state. */
+#define GLUT_DOWN 0
+#define GLUT_UP 1
+/* function keys */
+#define GLUT_KEY_F1 1
+#define GLUT_KEY_F2 2
+#define GLUT_KEY_F3 3
+#define GLUT_KEY_F4 4
+#define GLUT_KEY_F5 5
+#define GLUT_KEY_F6 6
+#define GLUT_KEY_F7 7
+#define GLUT_KEY_F8 8
+#define GLUT_KEY_F9 9
+#define GLUT_KEY_F10 10
+#define GLUT_KEY_F11 11
+#define GLUT_KEY_F12 12
+/* directional keys */
+#define GLUT_KEY_LEFT 100
+#define GLUT_KEY_UP 101
+#define GLUT_KEY_RIGHT 102
+#define GLUT_KEY_DOWN 103
+#define GLUT_KEY_PAGE_UP 104
+#define GLUT_KEY_PAGE_DOWN 105
+#define GLUT_KEY_HOME 106
+#define GLUT_KEY_END 107
+#define GLUT_KEY_INSERT 108
+/* Entry/exit state. */
+#define GLUT_LEFT 0
+#define GLUT_ENTERED 1
+/* Visibility state. */
+#define GLUT_VISIBLE 1
+/* Color index component selection values. */
+#define GLUT_RED 0
+#define GLUT_GREEN 1
+#define GLUT_BLUE 2
+/* Layers for use. */
+#define GLUT_NORMAL 0
+#define GLUT_OVERLAY 1
+/* Stroke font constants (use these in GLUT program). */
+#define GLUT_STROKE_ROMAN ((void*)0)
+#define GLUT_STROKE_MONO_ROMAN ((void*)1)
+/* Bitmap font constants (use these in GLUT program). */
+#define GLUT_BITMAP_9_BY_15 ((void*)2)
+#define GLUT_BITMAP_8_BY_13 ((void*)3)
+#define GLUT_BITMAP_TIMES_ROMAN_10 ((void*)4)
+#define GLUT_BITMAP_TIMES_ROMAN_24 ((void*)5)
+#define GLUT_BITMAP_HELVETICA_10 ((void*)6)
+#define GLUT_BITMAP_HELVETICA_12 ((void*)7)
+#define GLUT_BITMAP_HELVETICA_18 ((void*)8)
+/* glutGet parameters. */
+#define GLUT_WINDOW_X 100
+#define GLUT_WINDOW_Y 101
+#define GLUT_WINDOW_WIDTH 102
+#define GLUT_WINDOW_RGBA 116
+#define GLUT_SCREEN_WIDTH 200
+#define GLUT_MENU_NUM_ITEMS 300
+#define GLUT_INIT_WINDOW_X 500
+#define GLUT_INIT_WINDOW_Y 501
+#define GLUT_ELAPSED_TIME 700
+/* glutDeviceGet parameters. */
+#define GLUT_HAS_KEYBOARD 600
+#define GLUT_HAS_MOUSE 601
+#define GLUT_HAS_TABLET 604
+#define GLUT_NUM_DIALS 608
+#define GLUT_HAS_JOYSTICK 612
+/* glutLayerGet parameters. */
+#define GLUT_LAYER_IN_USE 801
+#define GLUT_HAS_OVERLAY 802
+/* glutVideoResizeGet parameters. */
+#define GLUT_VIDEO_RESIZE_X 906
+#define GLUT_VIDEO_RESIZE_Y 907
+/* glutUseLayer parameters. */
+#define GLUT_NORMAL 0
+#define GLUT_OVERLAY 1
+/* glutGetModifiers return mask. */
+#define GLUT_ACTIVE_ALT 4
+/* glutSetCursor parameters. */
+/* Basic arrows. */
+/* Symbolic cursor shapes. */
+/* Directional cursors. */
+/* Sizing cursors. */
+/* Inherit from parent window. */
+/* Blank cursor. */
+#define GLUT_CURSOR_NONE 101
+/* Fullscreen crosshair (if available). */
+/* GLUT initialization sub-API. */
+GLUTAPI void APIENTRY glutInit(int *argcp, char **argv);
+GLUTAPI void APIENTRY glutInitDisplayMode(unsigned int mode);
+GLUTAPI void APIENTRY glutInitWindowPosition(int x, int y);
+GLUTAPI void APIENTRY glutInitWindowSize(int width, int height);
+GLUTAPI void APIENTRY glutMainLoop(void);
+/* GLUT window sub-API. */
+GLUTAPI int APIENTRY glutCreateWindow(const char *title);
+GLUTAPI int APIENTRY glutCreateSubWindow(int win, int x, int y, int width, int height);
+GLUTAPI void APIENTRY glutDestroyWindow(int win);
+GLUTAPI void APIENTRY glutPostRedisplay(void);
+GLUTAPI void APIENTRY glutSwapBuffers(void);
+GLUTAPI int APIENTRY glutGetWindow(void);
+GLUTAPI void APIENTRY glutSetWindow(int win);
+GLUTAPI void APIENTRY glutSetWindowTitle(const char *title);
+GLUTAPI void APIENTRY glutSetIconTitle(const char *title);
+GLUTAPI void APIENTRY glutPositionWindow(int x, int y);
+GLUTAPI void APIENTRY glutReshapeWindow(int width, int height);
+GLUTAPI void APIENTRY glutPopWindow(void);
+GLUTAPI void APIENTRY glutPushWindow(void);
+GLUTAPI void APIENTRY glutIconifyWindow(void);
+GLUTAPI void APIENTRY glutShowWindow(void);
+GLUTAPI void APIENTRY glutHideWindow(void);
+/* GLUT overlay sub-API. */
+GLUTAPI void APIENTRY glutEstablishOverlay(void);
+GLUTAPI void APIENTRY glutRemoveOverlay(void);
+GLUTAPI void APIENTRY glutUseLayer(GLenum layer);
+GLUTAPI void APIENTRY glutPostOverlayRedisplay(void);
+GLUTAPI void APIENTRY glutShowOverlay(void);
+GLUTAPI void APIENTRY glutHideOverlay(void);
+/* GLUT menu sub-API. */
+GLUTAPI int APIENTRY glutCreateMenu(void (GLUTCALLBACK *)(int));
+GLUTAPI void APIENTRY glutDestroyMenu(int menu);
+GLUTAPI int APIENTRY glutGetMenu(void);
+GLUTAPI void APIENTRY glutSetMenu(int menu);
+GLUTAPI void APIENTRY glutAddMenuEntry(const char *label, int value);
+GLUTAPI void APIENTRY glutAddSubMenu(const char *label, int submenu);
+GLUTAPI void APIENTRY glutChangeToMenuEntry(int item, const char *label, int value);
+GLUTAPI void APIENTRY glutChangeToSubMenu(int item, const char *label, int submenu);
+GLUTAPI void APIENTRY glutRemoveMenuItem(int item);
+GLUTAPI void APIENTRY glutAttachMenu(int button);
+GLUTAPI void APIENTRY glutDetachMenu(int button);
+/* GLUT window callback sub-API. */
+GLUTAPI void APIENTRY glutDisplayFunc(void (GLUTCALLBACK * func)(void));
+GLUTAPI void APIENTRY glutReshapeFunc(void (GLUTCALLBACK * func)(int width, int height));
+GLUTAPI void APIENTRY glutKeyboardFunc(void (GLUTCALLBACK * func)(unsigned char key, int x, int y));
+GLUTAPI void APIENTRY glutMouseFunc(void (GLUTCALLBACK * func)(int button, int state, int x, int y));
+GLUTAPI void APIENTRY glutMotionFunc(void (GLUTCALLBACK * func)(int x, int y));
+GLUTAPI void APIENTRY glutPassiveMotionFunc(void (GLUTCALLBACK * func)(int x, int y));
+GLUTAPI void APIENTRY glutEntryFunc(void (GLUTCALLBACK * func)(int state));
+GLUTAPI void APIENTRY glutVisibilityFunc(void (GLUTCALLBACK * func)(int state));
+GLUTAPI void APIENTRY glutIdleFunc(void (GLUTCALLBACK * func)(void));
+GLUTAPI void APIENTRY glutTimerFunc(unsigned int millis, void (GLUTCALLBACK * func)(int value), int value);
+GLUTAPI void APIENTRY glutMenuStateFunc(void (GLUTCALLBACK * func)(int state));
+GLUTAPI void APIENTRY glutSpecialFunc(void (GLUTCALLBACK * func)(int key, int x, int y));
+GLUTAPI void APIENTRY glutSpaceballMotionFunc(void (GLUTCALLBACK * func)(int x, int y, int z));
+GLUTAPI void APIENTRY glutSpaceballRotateFunc(void (GLUTCALLBACK * func)(int x, int y, int z));
+GLUTAPI void APIENTRY glutSpaceballButtonFunc(void (GLUTCALLBACK * func)(int button, int state));
+GLUTAPI void APIENTRY glutButtonBoxFunc(void (GLUTCALLBACK * func)(int button, int state));
+GLUTAPI void APIENTRY glutDialsFunc(void (GLUTCALLBACK * func)(int dial, int value));
+GLUTAPI void APIENTRY glutTabletMotionFunc(void (GLUTCALLBACK * func)(int x, int y));
+GLUTAPI void APIENTRY glutTabletButtonFunc(void (GLUTCALLBACK * func)(int button, int state, int x, int y));
+GLUTAPI void APIENTRY glutMenuStatusFunc(void (GLUTCALLBACK * func)(int status, int x, int y));
+GLUTAPI void APIENTRY glutOverlayDisplayFunc(void (GLUTCALLBACK * func)(void));
+GLUTAPI void APIENTRY glutWindowStatusFunc(void (GLUTCALLBACK * func)(int state));
+/* GLUT color index sub-API. */
+GLUTAPI void APIENTRY glutSetColor(int, GLfloat red, GLfloat green, GLfloat blue);
+GLUTAPI GLfloat APIENTRY glutGetColor(int ndx, int component);
+GLUTAPI void APIENTRY glutCopyColormap(int win);
+/* GLUT state retrieval sub-API. */
+GLUTAPI int APIENTRY glutGet(GLenum type);
+GLUTAPI int APIENTRY glutDeviceGet(GLenum type);
+/* GLUT font sub-API */
+GLUTAPI void APIENTRY glutBitmapCharacter(void *font, int character);
+GLUTAPI int APIENTRY glutBitmapWidth(void *font, int character);
+GLUTAPI void APIENTRY glutStrokeCharacter(void *font, int character);
+GLUTAPI int APIENTRY glutStrokeWidth(void *font, int character);
+/* GLUT pre-built models sub-API */
+GLUTAPI void APIENTRY glutWireSphere(GLdouble radius, GLint slices, GLint stacks);
+GLUTAPI void APIENTRY glutSolidSphere(GLdouble radius, GLint slices, GLint stacks);
+GLUTAPI void APIENTRY glutWireCone(GLdouble base, GLdouble height, GLint slices, GLint stacks);
+GLUTAPI void APIENTRY glutSolidCone(GLdouble base, GLdouble height, GLint slices, GLint stacks);
+GLUTAPI void APIENTRY glutWireCube(GLdouble size);
+GLUTAPI void APIENTRY glutSolidCube(GLdouble size);
+GLUTAPI void APIENTRY glutWireTorus(GLdouble innerRadius, GLdouble outerRadius, GLint sides, GLint rings);
+GLUTAPI void APIENTRY glutSolidTorus(GLdouble innerRadius, GLdouble outerRadius, GLint sides, GLint rings);
+GLUTAPI void APIENTRY glutWireDodecahedron(void);
+GLUTAPI void APIENTRY glutSolidDodecahedron(void);
+GLUTAPI void APIENTRY glutWireTeapot(GLdouble size);
+GLUTAPI void APIENTRY glutSolidTeapot(GLdouble size);
+GLUTAPI void APIENTRY glutWireOctahedron(void);
+GLUTAPI void APIENTRY glutSolidOctahedron(void);
+GLUTAPI void APIENTRY glutWireTetrahedron(void);
+GLUTAPI void APIENTRY glutSolidTetrahedron(void);
+GLUTAPI void APIENTRY glutWireIcosahedron(void);
+GLUTAPI void APIENTRY glutSolidIcosahedron(void);
+#endif /* __AGLUT_H__ */
diff --git a/include/GL/glutf90.h b/include/GL/glutf90.h
new file mode 100644
index 0000000..7ba3e19
--- /dev/null
+++ b/include/GL/glutf90.h
@@ -0,0 +1,81 @@
+#ifndef __glutf90_h__
+#define __glutf90_h__
+/* Copyright (c) Mark J. Kilgard & Willam F. Mitchell, 1998. */
+/* This program is freely distributable without licensing fees
+ and is provided without guarantee or warrantee expressed or
+ implied. This program is -not- in the public domain. */
+/* This header provides the binding interface for William Mitchell's
+ f90gl Fortran 90 GLUT binding. Other GLUT language bindings
+ can and should use this interace. */
+/* I appreciate the guidance from William Mitchell
+ ( in developing this friend interface
+ for use by the f90gl package. See ../../README.fortran */
+#include <GL/glut.h>
+/* Which callback enumerants for the __glutSetFCB/__glutGetFCB routines. */
+/* NOTE These values are part of a binary interface for the f90gl Fortran
+ 90 binding and so must NOT changes (additions are allowed). */
+/* GLUTwindow callbacks. */
+#define GLUT_FCB_DISPLAY 0 /* GLUTdisplayFCB */
+#define GLUT_FCB_RESHAPE 1 /* GLUTreshapeFCB */
+#define GLUT_FCB_MOUSE 2 /* GLUTmouseFCB */
+#define GLUT_FCB_MOTION 3 /* GLUTmotionFCB */
+#define GLUT_FCB_PASSIVE 4 /* GLUTpassiveFCB */
+#define GLUT_FCB_ENTRY 5 /* GLUTentryFCB */
+#define GLUT_FCB_KEYBOARD 6 /* GLUTkeyboardFCB */
+#define GLUT_FCB_KEYBOARD_UP 7 /* GLUTkeyboardFCB */
+#define GLUT_FCB_WINDOW_STATUS 8 /* GLUTwindowStatusFCB */
+#define GLUT_FCB_VISIBILITY 9 /* GLUTvisibilityFCB */
+#define GLUT_FCB_SPECIAL 10 /* GLUTspecialFCB */
+#define GLUT_FCB_SPECIAL_UP 11 /* GLUTspecialFCB */
+#define GLUT_FCB_BUTTON_BOX 12 /* GLUTbuttonBoxFCB */
+#define GLUT_FCB_DIALS 13 /* GLUTdialsFCB */
+#define GLUT_FCB_SPACE_MOTION 14 /* GLUTspaceMotionFCB */
+#define GLUT_FCB_SPACE_ROTATE 15 /* GLUTspaceRotateFCB */
+#define GLUT_FCB_SPACE_BUTTON 16 /* GLUTspaceButtonFCB */
+#define GLUT_FCB_TABLET_MOTION 17 /* GLUTtabletMotionFCB */
+#define GLUT_FCB_TABLET_BUTTON 18 /* GLUTtabletButtonFCB */
+#define GLUT_FCB_JOYSTICK 19 /* GLUTjoystickFCB */
+/* Non-GLUTwindow callbacks. */
+#define GLUT_FCB_OVERLAY_DISPLAY 100 /* GLUTdisplayFCB */
+#define GLUT_FCB_SELECT 101 /* GLUTselectFCB */
+#define GLUT_FCB_TIMER 102 /* GLUTtimerFCB */
+/* GLUT Fortran callback function types. */
+typedef void (GLUTCALLBACK *GLUTdisplayFCB) (void);
+typedef void (GLUTCALLBACK *GLUTreshapeFCB) (int *, int *);
+/* NOTE the pressed key is int, not unsigned char for Fortran! */
+typedef void (GLUTCALLBACK *GLUTkeyboardFCB) (int *, int *, int *);
+typedef void (GLUTCALLBACK *GLUTmouseFCB) (int *, int *, int *, int *);
+typedef void (GLUTCALLBACK *GLUTmotionFCB) (int *, int *);
+typedef void (GLUTCALLBACK *GLUTpassiveFCB) (int *, int *);
+typedef void (GLUTCALLBACK *GLUTentryFCB) (int *);
+typedef void (GLUTCALLBACK *GLUTwindowStatusFCB) (int *);
+typedef void (GLUTCALLBACK *GLUTvisibilityFCB) (int *);
+typedef void (GLUTCALLBACK *GLUTspecialFCB) (int *, int *, int *);
+typedef void (GLUTCALLBACK *GLUTbuttonBoxFCB) (int *, int *);
+typedef void (GLUTCALLBACK *GLUTdialsFCB) (int *, int *);
+typedef void (GLUTCALLBACK *GLUTspaceMotionFCB) (int *, int *, int *);
+typedef void (GLUTCALLBACK *GLUTspaceRotateFCB) (int *, int *, int *);
+typedef void (GLUTCALLBACK *GLUTspaceButtonFCB) (int *, int *);
+typedef void (GLUTCALLBACK *GLUTtabletMotionFCB) (int *, int *);
+typedef void (GLUTCALLBACK *GLUTtabletButtonFCB) (int *, int *, int *, int *);
+typedef void (GLUTCALLBACK *GLUTjoystickFCB) (unsigned int *buttonMask, int *x, int *y, int *z);
+typedef void (GLUTCALLBACK *GLUTselectFCB) (int *);
+typedef void (GLUTCALLBACK *GLUTtimerFCB) (int *);
+typedef void (GLUTCALLBACK *GLUTmenuStateFCB) (int *); /* DEPRICATED. */
+typedef void (GLUTCALLBACK *GLUTmenuStatusFCB) (int *, int *, int *);
+typedef void (GLUTCALLBACK *GLUTidleFCB) (void);
+/* Functions that set and return Fortran callback functions. */
+GLUTAPI void* APIENTRY __glutGetFCB(int which);
+GLUTAPI void APIENTRY __glutSetFCB(int which, void *func);
+#endif /* __glutf90_h__ */
diff --git a/include/GL/glx.h b/include/GL/glx.h
new file mode 100644
index 0000000..c70a294
--- /dev/null
+++ b/include/GL/glx.h
@@ -0,0 +1,500 @@
+ * Mesa 3-D graphics library
+ * Version: 6.5
+ *
+ * Copyright (C) 1999-2006 Brian Paul All Rights Reserved.
+ *
+ * Permission is hereby granted, free of charge, to any person obtaining a
+ * copy of this software and associated documentation files (the "Software"),
+ * to deal in the Software without restriction, including without limitation
+ * the rights to use, copy, modify, merge, publish, distribute, sublicense,
+ * and/or sell copies of the Software, and to permit persons to whom the
+ * Software is furnished to do so, subject to the following conditions:
+ *
+ * The above copyright notice and this permission notice shall be included
+ * in all copies or substantial portions of the Software.
+ *
+ */
+#ifndef GLX_H
+#define GLX_H
+#ifdef __VMS
+#include <GL/vms_x_fix.h>
+# ifdef __cplusplus
+/* VMS Xlib.h gives problems with C++.
+ * this avoids a bunch of trivial warnings */
+#pragma message disable nosimpint
+#include <X11/Xlib.h>
+#include <X11/Xutil.h>
+#ifdef __VMS
+# ifdef __cplusplus
+#pragma message enable nosimpint
+#include <GL/gl.h>
+#if defined(USE_MGL_NAMESPACE)
+#include "glx_mangle.h"
+#ifdef __cplusplus
+extern "C" {
+#define GLX_VERSION_1_1 1
+#define GLX_VERSION_1_2 1
+#define GLX_VERSION_1_3 1
+#define GLX_VERSION_1_4 1
+ * Tokens for glXChooseVisual and glXGetConfig:
+ */
+#define GLX_USE_GL 1
+#define GLX_BUFFER_SIZE 2
+#define GLX_LEVEL 3
+#define GLX_RGBA 4
+#define GLX_STEREO 6
+#define GLX_AUX_BUFFERS 7
+#define GLX_RED_SIZE 8
+#define GLX_GREEN_SIZE 9
+#define GLX_BLUE_SIZE 10
+#define GLX_ALPHA_SIZE 11
+#define GLX_DEPTH_SIZE 12
+#define GLX_STENCIL_SIZE 13
+#define GLX_ACCUM_RED_SIZE 14
+ * Error codes returned by glXGetConfig:
+ */
+#define GLX_BAD_SCREEN 1
+#define GLX_BAD_VISUAL 4
+#define GLX_BAD_CONTEXT 5
+#define GLX_BAD_VALUE 6
+#define GLX_BAD_ENUM 7
+ * GLX 1.1 and later:
+ */
+#define GLX_VENDOR 1
+#define GLX_VERSION 2
+ * GLX 1.3 and later:
+ */
+#define GLX_CONFIG_CAVEAT 0x20
+#define GLX_X_VISUAL_TYPE 0x22
+#define GLX_WINDOW_BIT 0x00000001
+#define GLX_PIXMAP_BIT 0x00000002
+#define GLX_PBUFFER_BIT 0x00000004
+#define GLX_AUX_BUFFERS_BIT 0x00000010
+#define GLX_FRONT_LEFT_BUFFER_BIT 0x00000001
+#define GLX_FRONT_RIGHT_BUFFER_BIT 0x00000002
+#define GLX_BACK_LEFT_BUFFER_BIT 0x00000004
+#define GLX_BACK_RIGHT_BUFFER_BIT 0x00000008
+#define GLX_DEPTH_BUFFER_BIT 0x00000020
+#define GLX_STENCIL_BUFFER_BIT 0x00000040
+#define GLX_ACCUM_BUFFER_BIT 0x00000080
+#define GLX_NONE 0x8000
+#define GLX_SLOW_CONFIG 0x8001
+#define GLX_TRUE_COLOR 0x8002
+#define GLX_DIRECT_COLOR 0x8003
+#define GLX_PSEUDO_COLOR 0x8004
+#define GLX_STATIC_COLOR 0x8005
+#define GLX_GRAY_SCALE 0x8006
+#define GLX_STATIC_GRAY 0x8007
+#define GLX_TRANSPARENT_RGB 0x8008
+#define GLX_VISUAL_ID 0x800B
+#define GLX_SCREEN 0x800C
+#define GLX_DRAWABLE_TYPE 0x8010
+#define GLX_RENDER_TYPE 0x8011
+#define GLX_X_RENDERABLE 0x8012
+#define GLX_FBCONFIG_ID 0x8013
+#define GLX_RGBA_TYPE 0x8014
+#define GLX_COLOR_INDEX_TYPE 0x8015
+#define GLX_MAX_PBUFFER_WIDTH 0x8016
+#define GLX_MAX_PBUFFER_HEIGHT 0x8017
+#define GLX_MAX_PBUFFER_PIXELS 0x8018
+#define GLX_WIDTH 0x801D
+#define GLX_HEIGHT 0x801E
+#define GLX_EVENT_MASK 0x801F
+#define GLX_DAMAGED 0x8020
+#define GLX_SAVED 0x8021
+#define GLX_WINDOW 0x8022
+#define GLX_PBUFFER 0x8023
+#define GLX_PBUFFER_HEIGHT 0x8040
+#define GLX_PBUFFER_WIDTH 0x8041
+#define GLX_RGBA_BIT 0x00000001
+#define GLX_COLOR_INDEX_BIT 0x00000002
+#define GLX_PBUFFER_CLOBBER_MASK 0x08000000
+ * GLX 1.4 and later:
+ */
+#define GLX_SAMPLE_BUFFERS 0x186a0 /*100000*/
+#define GLX_SAMPLES 0x186a1 /*100001*/
+typedef struct __GLXcontextRec *GLXContext;
+typedef XID GLXPixmap;
+typedef XID GLXDrawable;
+/* GLX 1.3 and later */
+typedef struct __GLXFBConfigRec *GLXFBConfig;
+typedef XID GLXFBConfigID;
+typedef XID GLXContextID;
+typedef XID GLXWindow;
+typedef XID GLXPbuffer;
+extern XVisualInfo* glXChooseVisual( Display *dpy, int screen,
+ int *attribList );
+extern GLXContext glXCreateContext( Display *dpy, XVisualInfo *vis,
+ GLXContext shareList, Bool direct );
+extern void glXDestroyContext( Display *dpy, GLXContext ctx );
+extern Bool glXMakeCurrent( Display *dpy, GLXDrawable drawable,
+ GLXContext ctx);
+extern void glXCopyContext( Display *dpy, GLXContext src, GLXContext dst,
+ unsigned long mask );
+extern void glXSwapBuffers( Display *dpy, GLXDrawable drawable );
+extern GLXPixmap glXCreateGLXPixmap( Display *dpy, XVisualInfo *visual,
+ Pixmap pixmap );
+extern void glXDestroyGLXPixmap( Display *dpy, GLXPixmap pixmap );
+extern Bool glXQueryExtension( Display *dpy, int *errorb, int *event );
+extern Bool glXQueryVersion( Display *dpy, int *maj, int *min );
+extern Bool glXIsDirect( Display *dpy, GLXContext ctx );
+extern int glXGetConfig( Display *dpy, XVisualInfo *visual,
+ int attrib, int *value );
+extern GLXContext glXGetCurrentContext( void );
+extern GLXDrawable glXGetCurrentDrawable( void );
+extern void glXWaitGL( void );
+extern void glXWaitX( void );
+extern void glXUseXFont( Font font, int first, int count, int list );
+/* GLX 1.1 and later */
+extern const char *glXQueryExtensionsString( Display *dpy, int screen );
+extern const char *glXQueryServerString( Display *dpy, int screen, int name );
+extern const char *glXGetClientString( Display *dpy, int name );
+/* GLX 1.2 and later */
+extern Display *glXGetCurrentDisplay( void );
+/* GLX 1.3 and later */
+extern GLXFBConfig *glXChooseFBConfig( Display *dpy, int screen,
+ const int *attribList, int *nitems );
+extern int glXGetFBConfigAttrib( Display *dpy, GLXFBConfig config,
+ int attribute, int *value );
+extern GLXFBConfig *glXGetFBConfigs( Display *dpy, int screen,
+ int *nelements );
+extern XVisualInfo *glXGetVisualFromFBConfig( Display *dpy,
+ GLXFBConfig config );
+extern GLXWindow glXCreateWindow( Display *dpy, GLXFBConfig config,
+ Window win, const int *attribList );
+extern void glXDestroyWindow( Display *dpy, GLXWindow window );
+extern GLXPixmap glXCreatePixmap( Display *dpy, GLXFBConfig config,
+ Pixmap pixmap, const int *attribList );
+extern void glXDestroyPixmap( Display *dpy, GLXPixmap pixmap );
+extern GLXPbuffer glXCreatePbuffer( Display *dpy, GLXFBConfig config,
+ const int *attribList );
+extern void glXDestroyPbuffer( Display *dpy, GLXPbuffer pbuf );
+extern void glXQueryDrawable( Display *dpy, GLXDrawable draw, int attribute,
+ unsigned int *value );
+extern GLXContext glXCreateNewContext( Display *dpy, GLXFBConfig config,
+ int renderType, GLXContext shareList,
+ Bool direct );
+extern Bool glXMakeContextCurrent( Display *dpy, GLXDrawable draw,
+ GLXDrawable read, GLXContext ctx );
+extern GLXDrawable glXGetCurrentReadDrawable( void );
+extern int glXQueryContext( Display *dpy, GLXContext ctx, int attribute,
+ int *value );
+extern void glXSelectEvent( Display *dpy, GLXDrawable drawable,
+ unsigned long mask );
+extern void glXGetSelectedEvent( Display *dpy, GLXDrawable drawable,
+ unsigned long *mask );
+/* GLX 1.4 and later */
+extern void (*glXGetProcAddress(const GLubyte *procname))( void );
+#include <GL/glxext.h>
+ * ARB 2. GLX_ARB_get_proc_address
+ */
+#ifndef GLX_ARB_get_proc_address
+#define GLX_ARB_get_proc_address 1
+typedef void (*__GLXextFuncPtr)(void);
+extern __GLXextFuncPtr glXGetProcAddressARB (const GLubyte *);
+#endif /* GLX_ARB_get_proc_address */
+#endif /* GLX_GLXEXT_LEGACY */
+ ** The following aren't in glxext.h yet.
+ **/
+ * ???. GLX_NV_vertex_array_range
+ */
+#ifndef GLX_NV_vertex_array_range
+#define GLX_NV_vertex_array_range
+extern void *glXAllocateMemoryNV(GLsizei size, GLfloat readfreq, GLfloat writefreq, GLfloat priority);
+extern void glXFreeMemoryNV(GLvoid *pointer);
+typedef void * ( * PFNGLXALLOCATEMEMORYNVPROC) (GLsizei size, GLfloat readfreq, GLfloat writefreq, GLfloat priority);
+typedef void ( * PFNGLXFREEMEMORYNVPROC) (GLvoid *pointer);
+#endif /* GLX_NV_vertex_array_range */
+ * ???. GLX_MESA_allocate_memory
+ */
+#ifndef GLX_MESA_allocate_memory
+#define GLX_MESA_allocate_memory 1
+extern void *glXAllocateMemoryMESA(Display *dpy, int scrn, size_t size, float readfreq, float writefreq, float priority);
+extern void glXFreeMemoryMESA(Display *dpy, int scrn, void *pointer);
+extern GLuint glXGetMemoryOffsetMESA(Display *dpy, int scrn, const void *pointer);
+typedef void * ( * PFNGLXALLOCATEMEMORYMESAPROC) (Display *dpy, int scrn, size_t size, float readfreq, float writefreq, float priority);
+typedef void ( * PFNGLXFREEMEMORYMESAPROC) (Display *dpy, int scrn, void *pointer);
+typedef GLuint (* PFNGLXGETMEMORYOFFSETMESAPROC) (Display *dpy, int scrn, const void *pointer);
+#endif /* GLX_MESA_allocate_memory */
+ * ARB ?. GLX_ARB_render_texture
+ * XXX This was never finalized!
+ */
+#ifndef GLX_ARB_render_texture
+#define GLX_ARB_render_texture 1
+extern Bool glXBindTexImageARB(Display *dpy, GLXPbuffer pbuffer, int buffer);
+extern Bool glXReleaseTexImageARB(Display *dpy, GLXPbuffer pbuffer, int buffer);
+extern Bool glXDrawableAttribARB(Display *dpy, GLXDrawable draw, const int *attribList);
+#endif /* GLX_ARB_render_texture */
+ * Remove this when glxext.h is updated.
+ */
+#ifndef GLX_NV_float_buffer
+#define GLX_NV_float_buffer 1
+#endif /* GLX_NV_float_buffer */
+ * #?. GLX_MESA_swap_frame_usage
+ */
+#ifndef GLX_MESA_swap_frame_usage
+#define GLX_MESA_swap_frame_usage 1
+extern int glXGetFrameUsageMESA(Display *dpy, GLXDrawable drawable, float *usage);
+extern int glXBeginFrameTrackingMESA(Display *dpy, GLXDrawable drawable);
+extern int glXEndFrameTrackingMESA(Display *dpy, GLXDrawable drawable);
+extern int glXQueryFrameTrackingMESA(Display *dpy, GLXDrawable drawable, int64_t *swapCount, int64_t *missedFrames, float *lastMissedUsage);
+typedef int (*PFNGLXGETFRAMEUSAGEMESAPROC) (Display *dpy, GLXDrawable drawable, float *usage);
+typedef int (*PFNGLXBEGINFRAMETRACKINGMESAPROC)(Display *dpy, GLXDrawable drawable);
+typedef int (*PFNGLXENDFRAMETRACKINGMESAPROC)(Display *dpy, GLXDrawable drawable);
+typedef int (*PFNGLXQUERYFRAMETRACKINGMESAPROC)(Display *dpy, GLXDrawable drawable, int64_t *swapCount, int64_t *missedFrames, float *lastMissedUsage);
+#endif /* GLX_MESA_swap_frame_usage */
+ * #?. GLX_MESA_swap_control
+ */
+#ifndef GLX_MESA_swap_control
+#define GLX_MESA_swap_control 1
+extern int glXSwapIntervalMESA(unsigned int interval);
+extern int glXGetSwapIntervalMESA(void);
+typedef int (*PFNGLXSWAPINTERVALMESAPROC)(unsigned int interval);
+#endif /* GLX_MESA_swap_control */
+ * #?. GLX_EXT_texture_from_pixmap
+ * XXX not finished?
+ */
+#ifndef GLX_EXT_texture_from_pixmap
+#define GLX_EXT_texture_from_pixmap 1
+#define GLX_Y_INVERTED_EXT 0x20D4
+#define GLX_TEXTURE_1D_BIT_EXT 0x00000001
+#define GLX_TEXTURE_2D_BIT_EXT 0x00000002
+#define GLX_TEXTURE_1D_EXT 0x20DB
+#define GLX_TEXTURE_2D_EXT 0x20DC
+#define GLX_FRONT_LEFT_EXT 0x20DE
+#define GLX_BACK_LEFT_EXT 0x20E0
+#define GLX_BACK_RIGHT_EXT 0x20E1
+#define GLX_AUX0_EXT 0x20E2
+#define GLX_AUX1_EXT 0x20E3
+#define GLX_AUX2_EXT 0x20E4
+#define GLX_AUX3_EXT 0x20E5
+#define GLX_AUX4_EXT 0x20E6
+#define GLX_AUX5_EXT 0x20E7
+#define GLX_AUX6_EXT 0x20E8
+#define GLX_AUX7_EXT 0x20E9
+#define GLX_AUX8_EXT 0x20EA
+#define GLX_AUX9_EXT 0x20EB
+extern void glXBindTexImageEXT(Display *dpy, GLXDrawable drawable, int buffer, const int *attrib_list);
+extern void glXReleaseTexImageEXT(Display *dpy, GLXDrawable drawable, int buffer);
+#endif /* GLX_EXT_texture_from_pixmap */
+/*** Should these go here, or in another header? */
+** GLX Events
+typedef struct {
+ int event_type; /* GLX_DAMAGED or GLX_SAVED */
+ int draw_type; /* GLX_WINDOW or GLX_PBUFFER */
+ unsigned long serial; /* # of last request processed by server */
+ Bool send_event; /* true if this came for SendEvent request */
+ Display *display; /* display the event was read from */
+ GLXDrawable drawable; /* XID of Drawable */
+ unsigned int buffer_mask; /* mask indicating which buffers are affected */
+ unsigned int aux_buffer; /* which aux buffer was affected */
+ int x, y;
+ int width, height;
+ int count; /* if nonzero, at least this many more */
+} GLXPbufferClobberEvent;
+typedef union __GLXEvent {
+ GLXPbufferClobberEvent glxpbufferclobber;
+ long pad[24];
+} GLXEvent;
+#ifdef __cplusplus
diff --git a/include/GL/glx_mangle.h b/include/GL/glx_mangle.h
new file mode 100644
index 0000000..d0b47d9
--- /dev/null
+++ b/include/GL/glx_mangle.h
@@ -0,0 +1,55 @@
+ * Mesa 3-D graphics library
+ * Version: 4.1
+ * Copyright (C) 1995-1998 Brian Paul
+ *
+ * This library is free software; you can redistribute it and/or
+ * modify it under the terms of the GNU Library General Public
+ * License as published by the Free Software Foundation; either
+ * version 2 of the License, or (at your option) any later version.
+ *
+ * This library is distributed in the hope that it will be useful,
+ * but WITHOUT ANY WARRANTY; without even the implied warranty of
+ * Library General Public License for more details.
+ *
+ * You should have received a copy of the GNU Library General Public
+ * License along with this library; if not, write to the Free
+ * Software Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA.
+ */
+#ifndef GLX_MANGLE_H
+#define GLX_MANGLE_H
+#define glXChooseVisual mglXChooseVisual
+#define glXCreateContext mglXCreateContext
+#define glXDestroyContext mglXDestroyContext
+#define glXMakeCurrent mglXMakeCurrent
+#define glXCopyContext mglXCopyContext
+#define glXSwapBuffers mglXSwapBuffers
+#define glXCreateGLXPixmap mglXCreateGLXPixmap
+#define glXDestroyGLXPixmap mglXDestroyGLXPixmap
+#define glXQueryExtension mglXQueryExtension
+#define glXQueryVersion mglXQueryVersion
+#define glXIsDirect mglXIsDirect
+#define glXGetConfig mglXGetConfig
+#define glXGetCurrentContext mglXGetCurrentContext
+#define glXGetCurrentDrawable mglXGetCurrentDrawable
+#define glXWaitGL mglXWaitGL
+#define glXWaitX mglXWaitX
+#define glXUseXFont mglXUseXFont
+#define glXQueryExtensionsString mglXQueryExtensionsString
+#define glXQueryServerString mglXQueryServerString
+#define glXGetClientString mglXGetClientString
+#define glXCreateGLXPixmapMESA mglXCreateGLXPixmapMESA
+#define glXReleaseBuffersMESA mglXReleaseBuffersMESA
+#define glXCopySubBufferMESA mglXCopySubBufferMESA
+#define glXGetVideoSyncSGI mglXGetVideoSyncSGI
+#define glXWaitVideoSyncSGI mglXWaitVideoSyncSGI
+/* GLX 1.4 */
+#define glXGetProcAddress mglXGetProcAddress
diff --git a/include/GL/glxext.h b/include/GL/glxext.h
new file mode 100644
index 0000000..fa58593
--- /dev/null
+++ b/include/GL/glxext.h
@@ -0,0 +1,693 @@
+#ifndef __glxext_h_
+#define __glxext_h_
+#ifdef __cplusplus
+extern "C" {
+** License Applicability. Except to the extent portions of this file are
+** made subject to an alternative license as permitted in the SGI Free
+** Software License B, Version 1.1 (the "License"), the contents of this
+** file are subject only to the provisions of the License. You may not use
+** this file except in compliance with the License. You may obtain a copy
+** of the License at Silicon Graphics, Inc., attn: Legal Services, 1600
+** Amphitheatre Parkway, Mountain View, CA 94043-1351, or at:
+** Note that, as provided in the License, the Software is distributed on an
+** Original Code. The Original Code is: OpenGL Sample Implementation,
+** Version 1.2.1, released January 26, 2000, developed by Silicon Graphics,
+** Inc. The Original Code is Copyright (c) 1991-2004 Silicon Graphics, Inc.
+** Copyright in any portions created by third parties is as indicated
+** elsewhere herein. All Rights Reserved.
+** Additional Notice Provisions: This software was created using the
+** OpenGL(R) version 1.2.1 Sample Implementation published by SGI, but has
+** not been independently verified as being compliant with the OpenGL(R)
+** version 1.2.1 Specification.
+#if defined(_WIN32) && !defined(APIENTRY) && !defined(__CYGWIN__) && !defined(__SCITECH_SNAP__)
+#define WIN32_LEAN_AND_MEAN 1
+#include <windows.h>
+#ifndef APIENTRY
+#define APIENTRY
+#ifndef APIENTRYP
+#ifndef GLAPI
+#define GLAPI extern
+/* Header file version number, required by OpenGL ABI for Linux */
+/* glxext.h last updated 2004/07/26 */
+/* Current version at */
+#ifndef GLX_VERSION_1_3
+#define GLX_WINDOW_BIT 0x00000001
+#define GLX_PIXMAP_BIT 0x00000002
+#define GLX_PBUFFER_BIT 0x00000004
+#define GLX_RGBA_BIT 0x00000001
+#define GLX_COLOR_INDEX_BIT 0x00000002
+#define GLX_PBUFFER_CLOBBER_MASK 0x08000000
+#define GLX_FRONT_LEFT_BUFFER_BIT 0x00000001
+#define GLX_FRONT_RIGHT_BUFFER_BIT 0x00000002
+#define GLX_BACK_LEFT_BUFFER_BIT 0x00000004
+#define GLX_BACK_RIGHT_BUFFER_BIT 0x00000008
+#define GLX_AUX_BUFFERS_BIT 0x00000010
+#define GLX_DEPTH_BUFFER_BIT 0x00000020
+#define GLX_STENCIL_BUFFER_BIT 0x00000040
+#define GLX_ACCUM_BUFFER_BIT 0x00000080
+#define GLX_CONFIG_CAVEAT 0x20
+#define GLX_X_VISUAL_TYPE 0x22
+#define GLX_NONE 0x8000
+#define GLX_SLOW_CONFIG 0x8001
+#define GLX_TRUE_COLOR 0x8002
+#define GLX_DIRECT_COLOR 0x8003
+#define GLX_PSEUDO_COLOR 0x8004
+#define GLX_STATIC_COLOR 0x8005
+#define GLX_GRAY_SCALE 0x8006
+#define GLX_STATIC_GRAY 0x8007
+#define GLX_TRANSPARENT_RGB 0x8008
+#define GLX_VISUAL_ID 0x800B
+#define GLX_SCREEN 0x800C
+#define GLX_DRAWABLE_TYPE 0x8010
+#define GLX_RENDER_TYPE 0x8011
+#define GLX_X_RENDERABLE 0x8012
+#define GLX_FBCONFIG_ID 0x8013
+#define GLX_RGBA_TYPE 0x8014
+#define GLX_COLOR_INDEX_TYPE 0x8015
+#define GLX_MAX_PBUFFER_WIDTH 0x8016
+#define GLX_MAX_PBUFFER_HEIGHT 0x8017
+#define GLX_MAX_PBUFFER_PIXELS 0x8018
+#define GLX_WIDTH 0x801D
+#define GLX_HEIGHT 0x801E
+#define GLX_EVENT_MASK 0x801F
+#define GLX_DAMAGED 0x8020
+#define GLX_SAVED 0x8021
+#define GLX_WINDOW 0x8022
+#define GLX_PBUFFER 0x8023
+#define GLX_PBUFFER_HEIGHT 0x8040
+#define GLX_PBUFFER_WIDTH 0x8041
+#ifndef GLX_VERSION_1_4
+#define GLX_SAMPLE_BUFFERS 100000
+#define GLX_SAMPLES 100001
+#ifndef GLX_ARB_get_proc_address
+#ifndef GLX_ARB_multisample
+#define GLX_SAMPLE_BUFFERS_ARB 100000
+#define GLX_SAMPLES_ARB 100001
+#ifndef GLX_SGIS_multisample
+#define GLX_SAMPLES_SGIS 100001
+#ifndef GLX_EXT_visual_info
+#define GLX_X_VISUAL_TYPE_EXT 0x22
+#define GLX_NONE_EXT 0x8000
+#define GLX_TRUE_COLOR_EXT 0x8002
+#define GLX_DIRECT_COLOR_EXT 0x8003
+#define GLX_PSEUDO_COLOR_EXT 0x8004
+#define GLX_STATIC_COLOR_EXT 0x8005
+#define GLX_GRAY_SCALE_EXT 0x8006
+#define GLX_STATIC_GRAY_EXT 0x8007
+#ifndef GLX_SGI_swap_control
+#ifndef GLX_SGI_video_sync
+#ifndef GLX_SGI_make_current_read
+#ifndef GLX_SGIX_video_source
+#ifndef GLX_EXT_visual_rating
+#define GLX_SLOW_VISUAL_EXT 0x8001
+/* reuse GLX_NONE_EXT */
+#ifndef GLX_EXT_import_context
+#define GLX_VISUAL_ID_EXT 0x800B
+#define GLX_SCREEN_EXT 0x800C
+#ifndef GLX_SGIX_fbconfig
+#define GLX_WINDOW_BIT_SGIX 0x00000001
+#define GLX_PIXMAP_BIT_SGIX 0x00000002
+#define GLX_RGBA_BIT_SGIX 0x00000001
+#define GLX_COLOR_INDEX_BIT_SGIX 0x00000002
+#define GLX_DRAWABLE_TYPE_SGIX 0x8010
+#define GLX_RENDER_TYPE_SGIX 0x8011
+#define GLX_X_RENDERABLE_SGIX 0x8012
+#define GLX_FBCONFIG_ID_SGIX 0x8013
+#define GLX_RGBA_TYPE_SGIX 0x8014
+/* reuse GLX_SCREEN_EXT */
+#ifndef GLX_SGIX_pbuffer
+#define GLX_PBUFFER_BIT_SGIX 0x00000004
+#define GLX_BUFFER_CLOBBER_MASK_SGIX 0x08000000
+#define GLX_FRONT_LEFT_BUFFER_BIT_SGIX 0x00000001
+#define GLX_BACK_LEFT_BUFFER_BIT_SGIX 0x00000004
+#define GLX_BACK_RIGHT_BUFFER_BIT_SGIX 0x00000008
+#define GLX_AUX_BUFFERS_BIT_SGIX 0x00000010
+#define GLX_DEPTH_BUFFER_BIT_SGIX 0x00000020
+#define GLX_STENCIL_BUFFER_BIT_SGIX 0x00000040
+#define GLX_ACCUM_BUFFER_BIT_SGIX 0x00000080
+#define GLX_SAMPLE_BUFFERS_BIT_SGIX 0x00000100
+#define GLX_WIDTH_SGIX 0x801D
+#define GLX_HEIGHT_SGIX 0x801E
+#define GLX_EVENT_MASK_SGIX 0x801F
+#define GLX_DAMAGED_SGIX 0x8020
+#define GLX_SAVED_SGIX 0x8021
+#define GLX_WINDOW_SGIX 0x8022
+#define GLX_PBUFFER_SGIX 0x8023
+#ifndef GLX_SGI_cushion
+#ifndef GLX_SGIX_video_resize
+#define GLX_SYNC_FRAME_SGIX 0x00000000
+#define GLX_SYNC_SWAP_SGIX 0x00000001
+#ifndef GLX_SGIX_dmbuffer
+#ifndef GLX_SGIX_swap_group
+#ifndef GLX_SGIX_swap_barrier
+#ifndef GLX_SGIS_blended_overlay
+#define GLX_BLENDED_RGBA_SGIS 0x8025
+#ifndef GLX_SGIS_shared_multisample
+#ifndef GLX_SUN_get_transparent_index
+#ifndef GLX_3DFX_multisample
+#define GLX_SAMPLE_BUFFERS_3DFX 0x8050
+#define GLX_SAMPLES_3DFX 0x8051
+#ifndef GLX_MESA_copy_sub_buffer
+#ifndef GLX_MESA_pixmap_colormap
+#ifndef GLX_MESA_release_buffers
+#ifndef GLX_MESA_set_3dfx_mode
+#ifndef GLX_SGIX_visual_select_group
+#ifndef GLX_OML_swap_method
+#define GLX_SWAP_METHOD_OML 0x8060
+#define GLX_SWAP_EXCHANGE_OML 0x8061
+#define GLX_SWAP_COPY_OML 0x8062
+#define GLX_SWAP_UNDEFINED_OML 0x8063
+#ifndef GLX_OML_sync_control
+#ifndef GLX_SGIX_hyperpipe_group
+#define GLX_PIPE_RECT_SGIX 0x00000001
+#define GLX_PIPE_RECT_LIMITS_SGIX 0x00000002
+#define GLX_HYPERPIPE_STEREO_SGIX 0x00000003
+#define GLX_HYPERPIPE_ID_SGIX 0x8030
+#ifndef GLX_MESA_agp_offset
+#ifndef GLX_ARB_get_proc_address
+typedef void (*__GLXextFuncPtr)(void);
+#ifndef GLX_SGIX_video_source
+typedef XID GLXVideoSourceSGIX;
+#ifndef GLX_SGIX_fbconfig
+typedef XID GLXFBConfigIDSGIX;
+typedef struct __GLXFBConfigRec *GLXFBConfigSGIX;
+#ifndef GLX_SGIX_pbuffer
+typedef XID GLXPbufferSGIX;
+typedef struct {
+ int type;
+ unsigned long serial; /* # of last request processed by server */
+ Bool send_event; /* true if this came for SendEvent request */
+ Display *display; /* display the event was read from */
+ GLXDrawable drawable; /* i.d. of Drawable */
+ int event_type; /* GLX_DAMAGED_SGIX or GLX_SAVED_SGIX */
+ int draw_type; /* GLX_WINDOW_SGIX or GLX_PBUFFER_SGIX */
+ unsigned int mask; /* mask indicating which buffers are affected*/
+ int x, y;
+ int width, height;
+ int count; /* if nonzero, at least this many more */
+} GLXBufferClobberEventSGIX;
+#if defined(__sun__) || defined(__osf__)
+#include <inttypes.h>
+#if defined(__STDC__)
+#if defined(__arch64__)
+typedef long int int64_t;
+typedef long long int int64_t;
+#endif /* __arch64__ */
+#endif /* __STDC__ */
+#elif defined(__UNIXOS2__) || defined(__SOL64__)
+typedef long int int32_t;
+typedef long long int int64_t;
+#elif defined( __VMS )
+#include <inttypes.h>
+#elif defined(__SCO__) || defined(__USLC__)
+#include <stdint.h>
+#elif defined(WIN32) && defined(__GNUC__)
+#include <stdint.h>
+#ifndef GLX_VERSION_1_3
+#define GLX_VERSION_1_3 1
+extern GLXFBConfig * glXGetFBConfigs (Display *, int, int *);
+extern GLXFBConfig * glXChooseFBConfig (Display *, int, const int *, int *);
+extern int glXGetFBConfigAttrib (Display *, GLXFBConfig, int, int *);
+extern XVisualInfo * glXGetVisualFromFBConfig (Display *, GLXFBConfig);
+extern GLXWindow glXCreateWindow (Display *, GLXFBConfig, Window, const int *);
+extern void glXDestroyWindow (Display *, GLXWindow);
+extern GLXPixmap glXCreatePixmap (Display *, GLXFBConfig, Pixmap, const int *);
+extern void glXDestroyPixmap (Display *, GLXPixmap);
+extern GLXPbuffer glXCreatePbuffer (Display *, GLXFBConfig, const int *);
+extern void glXDestroyPbuffer (Display *, GLXPbuffer);
+extern void glXQueryDrawable (Display *, GLXDrawable, int, unsigned int *);
+extern GLXContext glXCreateNewContext (Display *, GLXFBConfig, int, GLXContext, Bool);
+extern Bool glXMakeContextCurrent (Display *, GLXDrawable, GLXDrawable, GLXContext);
+extern GLXDrawable glXGetCurrentReadDrawable (void);
+extern Display * glXGetCurrentDisplay (void);
+extern int glXQueryContext (Display *, GLXContext, int, int *);
+extern void glXSelectEvent (Display *, GLXDrawable, unsigned long);
+extern void glXGetSelectedEvent (Display *, GLXDrawable, unsigned long *);
+typedef GLXFBConfig * ( * PFNGLXGETFBCONFIGSPROC) (Display *dpy, int screen, int *nelements);
+typedef GLXFBConfig * ( * PFNGLXCHOOSEFBCONFIGPROC) (Display *dpy, int screen, const int *attrib_list, int *nelements);
+typedef int ( * PFNGLXGETFBCONFIGATTRIBPROC) (Display *dpy, GLXFBConfig config, int attribute, int *value);
+typedef XVisualInfo * ( * PFNGLXGETVISUALFROMFBCONFIGPROC) (Display *dpy, GLXFBConfig config);
+typedef GLXWindow ( * PFNGLXCREATEWINDOWPROC) (Display *dpy, GLXFBConfig config, Window win, const int *attrib_list);
+typedef void ( * PFNGLXDESTROYWINDOWPROC) (Display *dpy, GLXWindow win);
+typedef GLXPixmap ( * PFNGLXCREATEPIXMAPPROC) (Display *dpy, GLXFBConfig config, Pixmap pixmap, const int *attrib_list);
+typedef void ( * PFNGLXDESTROYPIXMAPPROC) (Display *dpy, GLXPixmap pixmap);
+typedef GLXPbuffer ( * PFNGLXCREATEPBUFFERPROC) (Display *dpy, GLXFBConfig config, const int *attrib_list);
+typedef void ( * PFNGLXDESTROYPBUFFERPROC) (Display *dpy, GLXPbuffer pbuf);
+typedef void ( * PFNGLXQUERYDRAWABLEPROC) (Display *dpy, GLXDrawable draw, int attribute, unsigned int *value);
+typedef GLXContext ( * PFNGLXCREATENEWCONTEXTPROC) (Display *dpy, GLXFBConfig config, int render_type, GLXContext share_list, Bool direct);
+typedef Bool ( * PFNGLXMAKECONTEXTCURRENTPROC) (Display *dpy, GLXDrawable draw, GLXDrawable read, GLXContext ctx);
+typedef Display * ( * PFNGLXGETCURRENTDISPLAYPROC) (void);
+typedef int ( * PFNGLXQUERYCONTEXTPROC) (Display *dpy, GLXContext ctx, int attribute, int *value);
+typedef void ( * PFNGLXSELECTEVENTPROC) (Display *dpy, GLXDrawable draw, unsigned long event_mask);
+typedef void ( * PFNGLXGETSELECTEDEVENTPROC) (Display *dpy, GLXDrawable draw, unsigned long *event_mask);
+#ifndef GLX_VERSION_1_4
+#define GLX_VERSION_1_4 1
+extern __GLXextFuncPtr glXGetProcAddress (const GLubyte *);
+typedef __GLXextFuncPtr ( * PFNGLXGETPROCADDRESSPROC) (const GLubyte *procName);
+#ifndef GLX_ARB_get_proc_address
+#define GLX_ARB_get_proc_address 1
+extern __GLXextFuncPtr glXGetProcAddressARB (const GLubyte *);
+typedef __GLXextFuncPtr ( * PFNGLXGETPROCADDRESSARBPROC) (const GLubyte *procName);
+#ifndef GLX_ARB_multisample
+#define GLX_ARB_multisample 1
+#ifndef GLX_SGIS_multisample
+#define GLX_SGIS_multisample 1
+#ifndef GLX_EXT_visual_info
+#define GLX_EXT_visual_info 1
+#ifndef GLX_SGI_swap_control
+#define GLX_SGI_swap_control 1
+extern int glXSwapIntervalSGI (int);
+typedef int ( * PFNGLXSWAPINTERVALSGIPROC) (int interval);
+#ifndef GLX_SGI_video_sync
+#define GLX_SGI_video_sync 1
+extern int glXGetVideoSyncSGI (unsigned int *);
+extern int glXWaitVideoSyncSGI (int, int, unsigned int *);
+typedef int ( * PFNGLXGETVIDEOSYNCSGIPROC) (unsigned int *count);
+typedef int ( * PFNGLXWAITVIDEOSYNCSGIPROC) (int divisor, int remainder, unsigned int *count);
+#ifndef GLX_SGI_make_current_read
+#define GLX_SGI_make_current_read 1
+extern Bool glXMakeCurrentReadSGI (Display *, GLXDrawable, GLXDrawable, GLXContext);
+extern GLXDrawable glXGetCurrentReadDrawableSGI (void);
+typedef Bool ( * PFNGLXMAKECURRENTREADSGIPROC) (Display *dpy, GLXDrawable draw, GLXDrawable read, GLXContext ctx);
+#ifndef GLX_SGIX_video_source
+#define GLX_SGIX_video_source 1
+#ifdef _VL_H
+extern GLXVideoSourceSGIX glXCreateGLXVideoSourceSGIX (Display *, int, VLServer, VLPath, int, VLNode);
+extern void glXDestroyGLXVideoSourceSGIX (Display *, GLXVideoSourceSGIX);
+typedef GLXVideoSourceSGIX ( * PFNGLXCREATEGLXVIDEOSOURCESGIXPROC) (Display *display, int screen, VLServer server, VLPath path, int nodeClass, VLNode drainNode);
+typedef void ( * PFNGLXDESTROYGLXVIDEOSOURCESGIXPROC) (Display *dpy, GLXVideoSourceSGIX glxvideosource);
+#endif /* _VL_H */
+#ifndef GLX_EXT_visual_rating
+#define GLX_EXT_visual_rating 1
+#ifndef GLX_EXT_import_context
+#define GLX_EXT_import_context 1
+extern Display * glXGetCurrentDisplayEXT (void);
+extern int glXQueryContextInfoEXT (Display *, GLXContext, int, int *);
+extern GLXContextID glXGetContextIDEXT (const GLXContext);
+extern GLXContext glXImportContextEXT (Display *, GLXContextID);
+extern void glXFreeContextEXT (Display *, GLXContext);
+typedef Display * ( * PFNGLXGETCURRENTDISPLAYEXTPROC) (void);
+typedef int ( * PFNGLXQUERYCONTEXTINFOEXTPROC) (Display *dpy, GLXContext context, int attribute, int *value);
+typedef GLXContextID ( * PFNGLXGETCONTEXTIDEXTPROC) (const GLXContext context);
+typedef GLXContext ( * PFNGLXIMPORTCONTEXTEXTPROC) (Display *dpy, GLXContextID contextID);
+typedef void ( * PFNGLXFREECONTEXTEXTPROC) (Display *dpy, GLXContext context);
+#ifndef GLX_SGIX_fbconfig
+#define GLX_SGIX_fbconfig 1
+extern int glXGetFBConfigAttribSGIX (Display *, GLXFBConfigSGIX, int, int *);
+extern GLXFBConfigSGIX * glXChooseFBConfigSGIX (Display *, int, int *, int *);
+extern GLXPixmap glXCreateGLXPixmapWithConfigSGIX (Display *, GLXFBConfigSGIX, Pixmap);
+extern GLXContext glXCreateContextWithConfigSGIX (Display *, GLXFBConfigSGIX, int, GLXContext, Bool);
+extern XVisualInfo * glXGetVisualFromFBConfigSGIX (Display *, GLXFBConfigSGIX);
+extern GLXFBConfigSGIX glXGetFBConfigFromVisualSGIX (Display *, XVisualInfo *);
+typedef int ( * PFNGLXGETFBCONFIGATTRIBSGIXPROC) (Display *dpy, GLXFBConfigSGIX config, int attribute, int *value);
+typedef GLXFBConfigSGIX * ( * PFNGLXCHOOSEFBCONFIGSGIXPROC) (Display *dpy, int screen, int *attrib_list, int *nelements);
+typedef GLXPixmap ( * PFNGLXCREATEGLXPIXMAPWITHCONFIGSGIXPROC) (Display *dpy, GLXFBConfigSGIX config, Pixmap pixmap);
+typedef GLXContext ( * PFNGLXCREATECONTEXTWITHCONFIGSGIXPROC) (Display *dpy, GLXFBConfigSGIX config, int render_type, GLXContext share_list, Bool direct);
+typedef XVisualInfo * ( * PFNGLXGETVISUALFROMFBCONFIGSGIXPROC) (Display *dpy, GLXFBConfigSGIX config);
+typedef GLXFBConfigSGIX ( * PFNGLXGETFBCONFIGFROMVISUALSGIXPROC) (Display *dpy, XVisualInfo *vis);
+#ifndef GLX_SGIX_pbuffer
+#define GLX_SGIX_pbuffer 1
+extern GLXPbufferSGIX glXCreateGLXPbufferSGIX (Display *, GLXFBConfigSGIX, unsigned int, unsigned int, int *);
+extern void glXDestroyGLXPbufferSGIX (Display *, GLXPbufferSGIX);
+extern int glXQueryGLXPbufferSGIX (Display *, GLXPbufferSGIX, int, unsigned int *);
+extern void glXSelectEventSGIX (Display *, GLXDrawable, unsigned long);
+extern void glXGetSelectedEventSGIX (Display *, GLXDrawable, unsigned long *);
+typedef GLXPbufferSGIX ( * PFNGLXCREATEGLXPBUFFERSGIXPROC) (Display *dpy, GLXFBConfigSGIX config, unsigned int width, unsigned int height, int *attrib_list);
+typedef void ( * PFNGLXDESTROYGLXPBUFFERSGIXPROC) (Display *dpy, GLXPbufferSGIX pbuf);
+typedef int ( * PFNGLXQUERYGLXPBUFFERSGIXPROC) (Display *dpy, GLXPbufferSGIX pbuf, int attribute, unsigned int *value);
+typedef void ( * PFNGLXSELECTEVENTSGIXPROC) (Display *dpy, GLXDrawable drawable, unsigned long mask);
+typedef void ( * PFNGLXGETSELECTEDEVENTSGIXPROC) (Display *dpy, GLXDrawable drawable, unsigned long *mask);
+#ifndef GLX_SGI_cushion
+#define GLX_SGI_cushion 1
+extern void glXCushionSGI (Display *, Window, float);
+typedef void ( * PFNGLXCUSHIONSGIPROC) (Display *dpy, Window window, float cushion);
+#ifndef GLX_SGIX_video_resize
+#define GLX_SGIX_video_resize 1
+extern int glXBindChannelToWindowSGIX (Display *, int, int, Window);
+extern int glXChannelRectSGIX (Display *, int, int, int, int, int, int);
+extern int glXQueryChannelRectSGIX (Display *, int, int, int *, int *, int *, int *);
+extern int glXQueryChannelDeltasSGIX (Display *, int, int, int *, int *, int *, int *);
+extern int glXChannelRectSyncSGIX (Display *, int, int, GLenum);
+typedef int ( * PFNGLXBINDCHANNELTOWINDOWSGIXPROC) (Display *display, int screen, int channel, Window window);
+typedef int ( * PFNGLXCHANNELRECTSGIXPROC) (Display *display, int screen, int channel, int x, int y, int w, int h);
+typedef int ( * PFNGLXQUERYCHANNELRECTSGIXPROC) (Display *display, int screen, int channel, int *dx, int *dy, int *dw, int *dh);
+typedef int ( * PFNGLXQUERYCHANNELDELTASSGIXPROC) (Display *display, int screen, int channel, int *x, int *y, int *w, int *h);
+typedef int ( * PFNGLXCHANNELRECTSYNCSGIXPROC) (Display *display, int screen, int channel, GLenum synctype);
+#ifndef GLX_SGIX_dmbuffer
+#define GLX_SGIX_dmbuffer 1
+#ifdef _DM_BUFFER_H_
+extern Bool glXAssociateDMPbufferSGIX (Display *, GLXPbufferSGIX, DMparams *, DMbuffer);
+typedef Bool ( * PFNGLXASSOCIATEDMPBUFFERSGIXPROC) (Display *dpy, GLXPbufferSGIX pbuffer, DMparams *params, DMbuffer dmbuffer);
+#endif /* _DM_BUFFER_H_ */
+#ifndef GLX_SGIX_swap_group
+#define GLX_SGIX_swap_group 1
+extern void glXJoinSwapGroupSGIX (Display *, GLXDrawable, GLXDrawable);
+typedef void ( * PFNGLXJOINSWAPGROUPSGIXPROC) (Display *dpy, GLXDrawable drawable, GLXDrawable member);
+#ifndef GLX_SGIX_swap_barrier
+#define GLX_SGIX_swap_barrier 1
+extern void glXBindSwapBarrierSGIX (Display *, GLXDrawable, int);
+extern Bool glXQueryMaxSwapBarriersSGIX (Display *, int, int *);
+typedef void ( * PFNGLXBINDSWAPBARRIERSGIXPROC) (Display *dpy, GLXDrawable drawable, int barrier);
+typedef Bool ( * PFNGLXQUERYMAXSWAPBARRIERSSGIXPROC) (Display *dpy, int screen, int *max);
+#ifndef GLX_SUN_get_transparent_index
+#define GLX_SUN_get_transparent_index 1
+extern Status glXGetTransparentIndexSUN (Display *, Window, Window, long *);
+typedef Status ( * PFNGLXGETTRANSPARENTINDEXSUNPROC) (Display *dpy, Window overlay, Window underlay, long *pTransparentIndex);
+#ifndef GLX_MESA_copy_sub_buffer
+#define GLX_MESA_copy_sub_buffer 1
+extern void glXCopySubBufferMESA (Display *, GLXDrawable, int, int, int, int);
+typedef void ( * PFNGLXCOPYSUBBUFFERMESAPROC) (Display *dpy, GLXDrawable drawable, int x, int y, int width, int height);
+#ifndef GLX_MESA_pixmap_colormap
+#define GLX_MESA_pixmap_colormap 1
+extern GLXPixmap glXCreateGLXPixmapMESA (Display *, XVisualInfo *, Pixmap, Colormap);
+typedef GLXPixmap ( * PFNGLXCREATEGLXPIXMAPMESAPROC) (Display *dpy, XVisualInfo *visual, Pixmap pixmap, Colormap cmap);
+#ifndef GLX_MESA_release_buffers
+#define GLX_MESA_release_buffers 1
+extern Bool glXReleaseBuffersMESA (Display *, GLXDrawable);
+typedef Bool ( * PFNGLXRELEASEBUFFERSMESAPROC) (Display *dpy, GLXDrawable drawable);
+#ifndef GLX_MESA_set_3dfx_mode
+#define GLX_MESA_set_3dfx_mode 1
+extern Bool glXSet3DfxModeMESA (int);
+typedef Bool ( * PFNGLXSET3DFXMODEMESAPROC) (int mode);
+#ifndef GLX_SGIX_visual_select_group
+#define GLX_SGIX_visual_select_group 1
+#ifndef GLX_OML_swap_method
+#define GLX_OML_swap_method 1
+#ifndef GLX_OML_sync_control
+#define GLX_OML_sync_control 1
+extern Bool glXGetSyncValuesOML (Display *, GLXDrawable, int64_t *, int64_t *, int64_t *);
+extern Bool glXGetMscRateOML (Display *, GLXDrawable, int32_t *, int32_t *);
+extern int64_t glXSwapBuffersMscOML (Display *, GLXDrawable, int64_t, int64_t, int64_t);
+extern Bool glXWaitForMscOML (Display *, GLXDrawable, int64_t, int64_t, int64_t, int64_t *, int64_t *, int64_t *);
+extern Bool glXWaitForSbcOML (Display *, GLXDrawable, int64_t, int64_t *, int64_t *, int64_t *);
+typedef Bool ( * PFNGLXGETSYNCVALUESOMLPROC) (Display *dpy, GLXDrawable drawable, int64_t *ust, int64_t *msc, int64_t *sbc);
+typedef Bool ( * PFNGLXGETMSCRATEOMLPROC) (Display *dpy, GLXDrawable drawable, int32_t *numerator, int32_t *denominator);
+typedef int64_t ( * PFNGLXSWAPBUFFERSMSCOMLPROC) (Display *dpy, GLXDrawable drawable, int64_t target_msc, int64_t divisor, int64_t remainder);
+typedef Bool ( * PFNGLXWAITFORMSCOMLPROC) (Display *dpy, GLXDrawable drawable, int64_t target_msc, int64_t divisor, int64_t remainder, int64_t *ust, int64_t *msc, int64_t *sbc);
+typedef Bool ( * PFNGLXWAITFORSBCOMLPROC) (Display *dpy, GLXDrawable drawable, int64_t target_sbc, int64_t *ust, int64_t *msc, int64_t *sbc);
+#ifndef GLX_SGIX_hyperpipe_group
+#define GLX_SGIX_hyperpipe_group 1
+typedef struct {
+ int networkId;
+} GLXHyperpipeNetworkSGIX;
+typedef struct {
+ int channel;
+ unsigned int
+ participationType;
+ int timeSlice;
+} GLXHyperpipeConfigSGIX;
+typedef struct {
+ int srcXOrigin, srcYOrigin, srcWidth, srcHeight;
+ int destXOrigin, destYOrigin, destWidth, destHeight;
+} GLXPipeRect;
+typedef struct {
+ int XOrigin, YOrigin, maxHeight, maxWidth;
+} GLXPipeRectLimits;
+extern GLXHyperpipeNetworkSGIX * glXQueryHyperpipeNetworkSGIX (Display *, int *);
+extern int glXHyperpipeConfigSGIX (Display *, int, int, GLXHyperpipeConfigSGIX *, int *);
+extern GLXHyperpipeConfigSGIX * glXQueryHyperpipeConfigSGIX (Display *, int, int *);
+extern int glXDestroyHyperpipeConfigSGIX (Display *, int);
+extern int glXBindHyperpipeSGIX (Display *, int);
+extern int glXQueryHyperpipeBestAttribSGIX (Display *, int, int, int, void *, void *);
+extern int glXHyperpipeAttribSGIX (Display *, int, int, int, void *);
+extern int glXQueryHyperpipeAttribSGIX (Display *, int, int, int, void *);
+typedef GLXHyperpipeNetworkSGIX * ( * PFNGLXQUERYHYPERPIPENETWORKSGIXPROC) (Display *dpy, int *npipes);
+typedef int ( * PFNGLXHYPERPIPECONFIGSGIXPROC) (Display *dpy, int networkId, int npipes, GLXHyperpipeConfigSGIX *cfg, int *hpId);
+typedef GLXHyperpipeConfigSGIX * ( * PFNGLXQUERYHYPERPIPECONFIGSGIXPROC) (Display *dpy, int hpId, int *npipes);
+typedef int ( * PFNGLXDESTROYHYPERPIPECONFIGSGIXPROC) (Display *dpy, int hpId);
+typedef int ( * PFNGLXBINDHYPERPIPESGIXPROC) (Display *dpy, int hpId);
+typedef int ( * PFNGLXQUERYHYPERPIPEBESTATTRIBSGIXPROC) (Display *dpy, int timeSlice, int attrib, int size, void *attribList, void *returnAttribList);
+typedef int ( * PFNGLXHYPERPIPEATTRIBSGIXPROC) (Display *dpy, int timeSlice, int attrib, int size, void *attribList);
+typedef int ( * PFNGLXQUERYHYPERPIPEATTRIBSGIXPROC) (Display *dpy, int timeSlice, int attrib, int size, void *returnAttribList);
+#ifndef GLX_MESA_agp_offset
+#define GLX_MESA_agp_offset 1
+extern unsigned int glXGetAGPOffsetMESA (const void *);
+typedef unsigned int ( * PFNGLXGETAGPOFFSETMESAPROC) (const void *pointer);
+#ifdef __cplusplus
diff --git a/include/GL/glxtokens.h b/include/GL/glxtokens.h
new file mode 100644
index 0000000..9e1601a
--- /dev/null
+++ b/include/GL/glxtokens.h
@@ -0,0 +1,286 @@
+#ifndef __GLX_glxtokens_h__
+#define __GLX_glxtokens_h__
+/* $XFree86: xc/include/GL/glxtokens.h,v 1.5 2001/03/21 15:51:38 dawes Exp $ */
+** License Applicability. Except to the extent portions of this file are
+** made subject to an alternative license as permitted in the SGI Free
+** Software License B, Version 1.1 (the "License"), the contents of this
+** file are subject only to the provisions of the License. You may not use
+** this file except in compliance with the License. You may obtain a copy
+** of the License at Silicon Graphics, Inc., attn: Legal Services, 1600
+** Amphitheatre Parkway, Mountain View, CA 94043-1351, or at:
+** Note that, as provided in the License, the Software is distributed on an
+** Original Code. The Original Code is: OpenGL Sample Implementation,
+** Version 1.2.1, released January 26, 2000, developed by Silicon Graphics,
+** Inc. The Original Code is Copyright (c) 1991-2000 Silicon Graphics, Inc.
+** Copyright in any portions created by third parties is as indicated
+** elsewhere herein. All Rights Reserved.
+** Additional Notice Provisions: The application programming interfaces
+** established by SGI in conjunction with the Original Code are The
+** OpenGL(R) Graphics System: A Specification (Version 1.2.1), released
+** April 1, 1999; The OpenGL(R) Graphics System Utility Library (Version
+** 1.3), released November 4, 1998; and OpenGL(R) Graphics with the X
+** Window System(R) (Version 1.3), released October 19, 1998. This software
+** was created using the OpenGL(R) version 1.2.1 Sample Implementation
+** published by SGI, but has not been independently verified as being
+** compliant with the OpenGL(R) version 1.2.1 Specification.
+#ifdef __cplusplus
+extern "C" {
+#define GLX_VERSION_1_1 1
+#define GLX_VERSION_1_2 1
+#define GLX_VERSION_1_3 1
+#define GLX_VERSION_1_4 1
+** Visual Config Attributes (glXGetConfig, glXGetFBConfigAttrib)
+#define GLX_USE_GL 1 /* support GLX rendering */
+#define GLX_BUFFER_SIZE 2 /* depth of the color buffer */
+#define GLX_LEVEL 3 /* level in plane stacking */
+#define GLX_RGBA 4 /* true if RGBA mode */
+#define GLX_DOUBLEBUFFER 5 /* double buffering supported */
+#define GLX_STEREO 6 /* stereo buffering supported */
+#define GLX_AUX_BUFFERS 7 /* number of aux buffers */
+#define GLX_RED_SIZE 8 /* number of red component bits */
+#define GLX_GREEN_SIZE 9 /* number of green component bits */
+#define GLX_BLUE_SIZE 10 /* number of blue component bits */
+#define GLX_ALPHA_SIZE 11 /* number of alpha component bits */
+#define GLX_DEPTH_SIZE 12 /* number of depth bits */
+#define GLX_STENCIL_SIZE 13 /* number of stencil bits */
+#define GLX_ACCUM_RED_SIZE 14 /* number of red accum bits */
+#define GLX_ACCUM_GREEN_SIZE 15 /* number of green accum bits */
+#define GLX_ACCUM_BLUE_SIZE 16 /* number of blue accum bits */
+#define GLX_ACCUM_ALPHA_SIZE 17 /* number of alpha accum bits */
+** FBConfig-specific attributes
+#define GLX_X_VISUAL_TYPE 0x22
+#define GLX_CONFIG_CAVEAT 0x20 /* Like visual_info VISUAL_CAVEAT_EXT */
+#define GLX_DRAWABLE_TYPE 0x8010
+#define GLX_RENDER_TYPE 0x8011
+#define GLX_X_RENDERABLE 0x8012
+#define GLX_FBCONFIG_ID 0x8013
+#define GLX_MAX_PBUFFER_WIDTH 0x8016
+#define GLX_MAX_PBUFFER_HEIGHT 0x8017
+#define GLX_MAX_PBUFFER_PIXELS 0x8018
+#define GLX_VISUAL_ID 0x800B
+/* FBConfigSGIX Attributes */
+** Error return values from glXGetConfig. Success is indicated by
+** a value of 0.
+#define GLX_BAD_SCREEN 1 /* screen # is bad */
+#define GLX_BAD_ATTRIBUTE 2 /* attribute to get is bad */
+#define GLX_NO_EXTENSION 3 /* no glx extension on server */
+#define GLX_BAD_VISUAL 4 /* visual # not known by GLX */
+#define GLX_BAD_CONTEXT 5 /* returned only by import_context EXT? */
+#define GLX_BAD_VALUE 6 /* returned only by glXSwapIntervalSGI? */
+#define GLX_BAD_ENUM 7 /* unused? */
+/* FBConfig attribute values */
+** Generic "don't care" value for glX ChooseFBConfig attributes (except
+/* GLX_RENDER_TYPE bits */
+#define GLX_RGBA_BIT 0x00000001
+#define GLX_COLOR_INDEX_BIT 0x00000002
+#define GLX_WINDOW_BIT 0x00000001
+#define GLX_PIXMAP_BIT 0x00000002
+#define GLX_PBUFFER_BIT 0x00000004
+/* GLX_CONFIG_CAVEAT attribute values */
+#define GLX_NONE 0x8000
+#define GLX_SLOW_CONFIG 0x8001
+/* GLX_X_VISUAL_TYPE attribute values */
+#define GLX_TRUE_COLOR 0x8002
+#define GLX_DIRECT_COLOR 0x8003
+#define GLX_PSEUDO_COLOR 0x8004
+#define GLX_STATIC_COLOR 0x8005
+#define GLX_GRAY_SCALE 0x8006
+#define GLX_STATIC_GRAY 0x8007
+/* GLX_TRANSPARENT_TYPE attribute values */
+/* #define GLX_NONE 0x8000 */
+#define GLX_TRANSPARENT_RGB 0x8008
+/* glXCreateGLXPbuffer attributes */
+#define GLX_PBUFFER_HEIGHT 0x8040 /* New for GLX 1.3 */
+#define GLX_PBUFFER_WIDTH 0x8041 /* New for GLX 1.3 */
+/* glXQueryGLXPBuffer attributes */
+#define GLX_WIDTH 0x801D
+#define GLX_HEIGHT 0x801E
+#define GLX_EVENT_MASK 0x801F
+/* glXCreateNewContext render_type attribute values */
+#define GLX_RGBA_TYPE 0x8014
+#define GLX_COLOR_INDEX_TYPE 0x8015
+/* glXQueryContext attributes */
+/* #define GLX_FBCONFIG_ID 0x8013 */
+/* #define GLX_RENDER_TYPE 0x8011 */
+#define GLX_SCREEN 0x800C
+/* glXSelectEvent event mask bits */
+#define GLX_PBUFFER_CLOBBER_MASK 0x08000000
+/* GLXPbufferClobberEvent event_type values */
+#define GLX_DAMAGED 0x8020
+#define GLX_SAVED 0x8021
+/* GLXPbufferClobberEvent draw_type values */
+#define GLX_WINDOW 0x8022
+#define GLX_PBUFFER 0x8023
+/* GLXPbufferClobberEvent buffer_mask bits */
+#define GLX_FRONT_LEFT_BUFFER_BIT 0x00000001
+#define GLX_FRONT_RIGHT_BUFFER_BIT 0x00000002
+#define GLX_BACK_LEFT_BUFFER_BIT 0x00000004
+#define GLX_BACK_RIGHT_BUFFER_BIT 0x00000008
+#define GLX_AUX_BUFFERS_BIT 0x00000010
+#define GLX_DEPTH_BUFFER_BIT 0x00000020
+#define GLX_STENCIL_BUFFER_BIT 0x00000040
+#define GLX_ACCUM_BUFFER_BIT 0x00000080
+** Extension return values from glXGetConfig. These are also
+** accepted as parameter values for glXChooseVisual.
+#define GLX_X_VISUAL_TYPE_EXT 0x22 /* visual_info extension type */
+#define GLX_TRANSPARENT_TYPE_EXT 0x23 /* visual_info extension */
+#define GLX_TRANSPARENT_INDEX_VALUE_EXT 0x24 /* visual_info extension */
+#define GLX_TRANSPARENT_RED_VALUE_EXT 0x25 /* visual_info extension */
+#define GLX_TRANSPARENT_GREEN_VALUE_EXT 0x26 /* visual_info extension */
+#define GLX_TRANSPARENT_BLUE_VALUE_EXT 0x27 /* visual_info extension */
+#define GLX_TRANSPARENT_ALPHA_VALUE_EXT 0x28 /* visual_info extension */
+/* Property values for visual_type */
+#define GLX_TRUE_COLOR_EXT 0x8002
+#define GLX_DIRECT_COLOR_EXT 0x8003
+#define GLX_PSEUDO_COLOR_EXT 0x8004
+#define GLX_STATIC_COLOR_EXT 0x8005
+#define GLX_GRAY_SCALE_EXT 0x8006
+#define GLX_STATIC_GRAY_EXT 0x8007
+/* Property values for transparent pixel */
+#define GLX_NONE_EXT 0x8000
+/* Property values for visual_rating */
+#define GLX_VISUAL_CAVEAT_EXT 0x20 /* visual_rating extension type */
+#define GLX_SLOW_VISUAL_EXT 0x8001
+/* Property values for swap method (GLX_OML_swap_method) */
+#define GLX_SWAP_METHOD_OML 0x8060
+#define GLX_SWAP_EXCHANGE_OML 0x8061
+#define GLX_SWAP_COPY_OML 0x8062
+#define GLX_SWAP_UNDEFINED_OML 0x8063
+/* Property values for multi-sampling */
+#define GLX_VISUAL_SELECT_GROUP_SGIX 0x8028 /* visuals grouped by select priority */
+** Names for attributes to glXGetClientString.
+#define GLX_VENDOR 0x1
+#define GLX_VERSION 0x2
+#define GLX_EXTENSIONS 0x3
+** Names for attributes to glXQueryContextInfoEXT.
+#define GLX_SHARE_CONTEXT_EXT 0x800A /* id of share context */
+#define GLX_VISUAL_ID_EXT 0x800B /* id of context's visual */
+#define GLX_SCREEN_EXT 0x800C /* screen number */
+** GLX_EXT_texture_from_pixmap
+#define GLX_Y_INVERTED_EXT 0x20D4
+#define GLX_TEXTURE_1D_BIT_EXT 0x00000001
+#define GLX_TEXTURE_2D_BIT_EXT 0x00000002
+#define GLX_TEXTURE_1D_EXT 0x20DB
+#define GLX_TEXTURE_2D_EXT 0x20DC
+#define GLX_FRONT_LEFT_EXT 0x20DE
+#define GLX_BACK_LEFT_EXT 0x20E0
+#define GLX_BACK_RIGHT_EXT 0x20E1
+#define GLX_AUX0_EXT 0x20E2
+#define GLX_AUX1_EXT 0x20E3
+#define GLX_AUX2_EXT 0x20E4
+#define GLX_AUX3_EXT 0x20E5
+#define GLX_AUX4_EXT 0x20E6
+#define GLX_AUX5_EXT 0x20E7
+#define GLX_AUX6_EXT 0x20E8
+#define GLX_AUX7_EXT 0x20E9
+#define GLX_AUX8_EXT 0x20EA
+#define GLX_AUX9_EXT 0x20EB
+ * GLX 1.4 and later:
+ */
+#define GLX_SAMPLES_SGIS 100001
+#ifdef __cplusplus
+#endif /* !__GLX_glxtokens_h__ */
diff --git a/include/GL/internal/dri_interface.h b/include/GL/internal/dri_interface.h
new file mode 100644
index 0000000..c204ecf
--- /dev/null
+++ b/include/GL/internal/dri_interface.h
@@ -0,0 +1,485 @@
+ * Copyright 1998-1999 Precision Insight, Inc., Cedar Park, Texas.
+ * (C) Copyright IBM Corporation 2004
+ * All Rights Reserved.
+ *
+ * Permission is hereby granted, free of charge, to any person obtaining a
+ * copy of this software and associated documentation files (the "Software"),
+ * to deal in the Software without restriction, including without limitation
+ * on the rights to use, copy, modify, merge, publish, distribute, sub
+ * license, and/or sell copies of the Software, and to permit persons to whom
+ * the Software is furnished to do so, subject to the following conditions:
+ *
+ * The above copyright notice and this permission notice (including the next
+ * paragraph) shall be included in all copies or substantial portions of the
+ * Software.
+ *
+ */
+ * \file dri_interface.h
+ *
+ * This file contains all the types and functions that define the interface
+ * between a DRI driver and driver loader. Currently, the most common driver
+ * loader is the XFree86 However, other loaders do exist, and in
+ * the future the server-side libglx.a will also be a loader.
+ *
+ * \author Kevin E. Martin <>
+ * \author Ian Romanick <>
+ */
+#include <GL/internal/glcore.h>
+#include <drm.h>
+ * \name DRI interface structures
+ *
+ * The following structures define the interface between the GLX client
+ * side library and the DRI (direct rendering infrastructure).
+ */
+typedef struct __DRIdisplayRec __DRIdisplay;
+typedef struct __DRIscreenRec __DRIscreen;
+typedef struct __DRIcontextRec __DRIcontext;
+typedef struct __DRIdrawableRec __DRIdrawable;
+typedef struct __DRIdriverRec __DRIdriver;
+typedef struct __DRIframebufferRec __DRIframebuffer;
+typedef struct __DRIversionRec __DRIversion;
+typedef struct __DRIinterfaceMethodsRec __DRIinterfaceMethods;
+typedef unsigned long __DRIid;
+typedef void __DRInativeDisplay;
+ * \name Functions provided by the driver loader.
+ */
+ * Type of a pointer to \c glXGetScreenDriver, as returned by
+ * \c glXGetProcAddress. This function is used to get the name of the DRI
+ * driver for the specified screen of the specified display. The driver
+ * name is typically used with \c glXGetDriverConfig.
+ *
+ * \sa glXGetScreenDriver, glXGetProcAddress, glXGetDriverConfig
+ */
+typedef const char * (* PFNGLXGETSCREENDRIVERPROC) (__DRInativeDisplay *dpy, int scrNum);
+ * Type of a pointer to \c glXGetDriverConfig, as returned by
+ * \c glXGetProcAddress. This function is used to get the XML document
+ * describing the configuration options available for the specified driver.
+ *
+ * \sa glXGetDriverConfig, glXGetProcAddress, glXGetScreenDriver
+ */
+typedef const char * (* PFNGLXGETDRIVERCONFIGPROC) (const char *driverName);
+ * Type of a pointer to \c glxEnableExtension, as returned by
+ * \c __DRIinterfaceMethods::getProcAddress. This function is used to enable
+ * a GLX extension on the specified screen.
+ */
+typedef void (* PFNGLXSCRENABLEEXTENSIONPROC) ( void *psc, const char * name );
+ * \name Functions and data provided by the driver.
+ */
+typedef void *(CREATENEWSCREENFUNC)(__DRInativeDisplay *dpy, int scrn,
+ __DRIscreen *psc, const __GLcontextModes * modes,
+ const __DRIversion * ddx_version, const __DRIversion * dri_version,
+ const __DRIversion * drm_version, const __DRIframebuffer * frame_buffer,
+ void * pSAREA, int fd, int internal_api_version,
+ const __DRIinterfaceMethods * interface,
+ __GLcontextModes ** driver_modes);
+extern CREATENEWSCREENFUNC __driCreateNewScreen_20050727;
+ * XML document describing the configuration options supported by the
+ * driver.
+ */
+extern const char __driConfigOptions[];
+ * Stored version of some component (i.e., server-side DRI module, kernel-side
+ * DRM, etc.).
+ *
+ * \todo
+ * There are several data structures that explicitly store a major version,
+ * minor version, and patch level. These structures should be modified to
+ * have a \c __DRIversionRec instead.
+ */
+struct __DRIversionRec {
+ int major; /**< Major version number. */
+ int minor; /**< Minor version number. */
+ int patch; /**< Patch-level. */
+typedef void (*__DRIfuncPtr)(void);
+struct __DRIinterfaceMethodsRec {
+ /**
+ * Get pointer to named function.
+ */
+ __DRIfuncPtr (*getProcAddress)( const char * proc_name );
+ /**
+ * Create a list of \c __GLcontextModes structures.
+ */
+ __GLcontextModes * (*createContextModes)(unsigned count,
+ size_t minimum_bytes_per_struct);
+ /**
+ * Destroy a list of \c __GLcontextModes structures.
+ *
+ * \todo
+ * Determine if the drivers actually need to call this.
+ */
+ void (*destroyContextModes)( __GLcontextModes * modes );
+ /**
+ * Get the \c __DRIscreen for a given display and screen number.
+ */
+ __DRIscreen *(*getScreen)(__DRInativeDisplay *dpy, int screenNum);
+ /**
+ * \name Client/server protocol functions.
+ *
+ * These functions implement the DRI client/server protocol for
+ * context and drawable operations. Platforms that do not implement
+ * the wire protocol (e.g., EGL) will implement glorified no-op functions.
+ */
+ /*@{*/
+ /**
+ * Determine if the specified window ID still exists.
+ *
+ * \note
+ * Implementations may assume that the driver will only pass an ID into
+ * this function that actually corresponds to a window. On
+ * implementations where windows can only be destroyed by the DRI driver
+ * (e.g., EGL), this function is allowed to always return \c GL_TRUE.
+ */
+ GLboolean (*windowExists)(__DRInativeDisplay *dpy, __DRIid draw);
+ /**
+ * Create the server-side portion of the GL context.
+ */
+ GLboolean (* createContext)( __DRInativeDisplay *dpy, int screenNum,
+ int configID, void * contextID, drm_context_t * hw_context );
+ /**
+ * Destroy the server-side portion of the GL context.
+ */
+ GLboolean (* destroyContext)( __DRInativeDisplay *dpy, int screenNum,
+ __DRIid context );
+ /**
+ * Create the server-side portion of the drawable.
+ */
+ GLboolean (*createDrawable)( __DRInativeDisplay * ndpy, int screen,
+ __DRIid drawable, drm_drawable_t * hHWDrawable );
+ /**
+ * Destroy the server-side portion of the drawable.
+ */
+ GLboolean (*destroyDrawable)( __DRInativeDisplay * ndpy, int screen,
+ __DRIid drawable );
+ /**
+ * This function is used to get information about the position, size, and
+ * clip rects of a drawable.
+ */
+ GLboolean (* getDrawableInfo) ( __DRInativeDisplay *dpy, int scrn,
+ __DRIid draw, unsigned int * index, unsigned int * stamp,
+ int * x, int * y, int * width, int * height,
+ int * numClipRects, drm_clip_rect_t ** pClipRects,
+ int * backX, int * backY,
+ int * numBackClipRects, drm_clip_rect_t ** pBackClipRects );
+ /*@}*/
+ /**
+ * \name Timing related functions.
+ */
+ /*@{*/
+ /**
+ * Get the 64-bit unadjusted system time (UST).
+ */
+ int (*getUST)(int64_t * ust);
+ /**
+ * Get the media stream counter (MSC) rate.
+ *
+ * Matching the definition in GLX_OML_sync_control, this function returns
+ * the rate of the "media stream counter". In practical terms, this is
+ * the frame refresh rate of the display.
+ */
+ GLboolean (*getMSCRate)(__DRInativeDisplay * dpy, __DRIid drawable,
+ int32_t * numerator, int32_t * denominator);
+ /*@}*/
+ * Framebuffer information record. Used by libGL to communicate information
+ * about the framebuffer to the driver's \c __driCreateNewScreen function.
+ *
+ * In XFree86, most of this information is derrived from data returned by
+ * calling \c XF86DRIGetDeviceInfo.
+ *
+ * \sa XF86DRIGetDeviceInfo __DRIdisplayRec::createNewScreen
+ * __driUtilCreateNewScreen CallCreateNewScreen
+ *
+ * \bug This structure could be better named.
+ */
+struct __DRIframebufferRec {
+ unsigned char *base; /**< Framebuffer base address in the CPU's
+ * address space. This value is calculated by
+ * calling \c drmMap on the framebuffer handle
+ * returned by \c XF86DRIGetDeviceInfo (or a
+ * similar function).
+ */
+ int size; /**< Framebuffer size, in bytes. */
+ int stride; /**< Number of bytes from one line to the next. */
+ int width; /**< Pixel width of the framebuffer. */
+ int height; /**< Pixel height of the framebuffer. */
+ int dev_priv_size; /**< Size of the driver's dev-priv structure. */
+ void *dev_priv; /**< Pointer to the driver's dev-priv structure. */
+ * Screen dependent methods. This structure is initialized during the
+ * \c __DRIdisplayRec::createScreen call.
+ */
+struct __DRIscreenRec {
+ /**
+ * Method to destroy the private DRI screen data.
+ */
+ void (*destroyScreen)(__DRInativeDisplay *dpy, int scrn, void *screenPrivate);
+ /**
+ * Method to create the private DRI drawable data and initialize the
+ * drawable dependent methods.
+ */
+ void *(*createNewDrawable)(__DRInativeDisplay *dpy, const __GLcontextModes *modes,
+ __DRIid draw, __DRIdrawable *pdraw,
+ int renderType, const int *attrs);
+ /**
+ * Method to return a pointer to the DRI drawable data.
+ */
+ __DRIdrawable *(*getDrawable)(__DRInativeDisplay *dpy, __DRIid draw,
+ void *drawablePrivate);
+ /**
+ * Opaque pointer to private per screen direct rendering data. \c NULL
+ * if direct rendering is not supported on this screen. Never
+ * dereferenced in libGL.
+ */
+ void *private;
+ /**
+ * Get the number of vertical refreshes since some point in time before
+ * this function was first called (i.e., system start up).
+ *
+ * \since Internal API version 20030317.
+ */
+ int (*getMSC)( void *screenPrivate, int64_t *msc );
+ /**
+ * Opaque pointer that points back to the containing
+ * \c __GLXscreenConfigs. This data structure is shared with DRI drivers
+ * but \c __GLXscreenConfigs is not. However, they are needed by some GLX
+ * functions called by DRI drivers.
+ *
+ * \since Internal API version 20030813.
+ */
+ void *screenConfigs;
+ /**
+ * Functions associated with MESA_allocate_memory.
+ *
+ * \since Internal API version 20030815.
+ */
+ /*@{*/
+ void *(*allocateMemory)(__DRInativeDisplay *dpy, int scrn, GLsizei size,
+ GLfloat readfreq, GLfloat writefreq,
+ GLfloat priority);
+ void (*freeMemory)(__DRInativeDisplay *dpy, int scrn, GLvoid *pointer);
+ GLuint (*memoryOffset)(__DRInativeDisplay *dpy, int scrn, const GLvoid *pointer);
+ /*@}*/
+ /**
+ * Method to create the private DRI context data and initialize the
+ * context dependent methods.
+ *
+ * \since Internal API version 20031201.
+ */
+ void * (*createNewContext)(__DRInativeDisplay *dpy, const __GLcontextModes *modes,
+ int render_type,
+ void *sharedPrivate, __DRIcontext *pctx);
+ * Context dependent methods. This structure is initialized during the
+ * \c __DRIscreenRec::createContext call.
+ */
+struct __DRIcontextRec {
+ /**
+ * Method to destroy the private DRI context data.
+ */
+ void (*destroyContext)(__DRInativeDisplay *dpy, int scrn, void *contextPrivate);
+ /**
+ * Opaque pointer to private per context direct rendering data.
+ * \c NULL if direct rendering is not supported on the display or
+ * screen used to create this context. Never dereferenced in libGL.
+ */
+ void *private;
+ /**
+ * Pointer to the mode used to create this context.
+ *
+ * \since Internal API version 20040317.
+ */
+ const __GLcontextModes * mode;
+ /**
+ * Method to bind a DRI drawable to a DRI graphics context.
+ *
+ * \since Internal API version 20050727.
+ */
+ GLboolean (*bindContext)(__DRInativeDisplay *dpy, int scrn, __DRIid draw,
+ __DRIid read, __DRIcontext *ctx);
+ /**
+ * Method to unbind a DRI drawable from a DRI graphics context.
+ *
+ * \since Internal API version 20050727.
+ */
+ GLboolean (*unbindContext)(__DRInativeDisplay *dpy, int scrn, __DRIid draw,
+ __DRIid read, __DRIcontext *ctx);
+ * Drawable dependent methods. This structure is initialized during the
+ * \c __DRIscreenRec::createDrawable call. \c createDrawable is not called
+ * by libGL at this time. It's currently used via the dri_util.c utility code
+ * instead.
+ */
+struct __DRIdrawableRec {
+ /**
+ * Method to destroy the private DRI drawable data.
+ */
+ void (*destroyDrawable)(__DRInativeDisplay *dpy, void *drawablePrivate);
+ /**
+ * Method to swap the front and back buffers.
+ */
+ void (*swapBuffers)(__DRInativeDisplay *dpy, void *drawablePrivate);
+ /**
+ * Opaque pointer to private per drawable direct rendering data.
+ * \c NULL if direct rendering is not supported on the display or
+ * screen used to create this drawable. Never dereferenced in libGL.
+ */
+ void *private;
+ /**
+ * Get the number of completed swap buffers for this drawable.
+ *
+ * \since Internal API version 20030317.
+ */
+ int (*getSBC)(__DRInativeDisplay *dpy, void *drawablePrivate, int64_t *sbc );
+ /**
+ * Wait for the SBC to be greater than or equal target_sbc.
+ *
+ * \since Internal API version 20030317.
+ */
+ int (*waitForSBC)( __DRInativeDisplay * dpy, void *drawablePriv,
+ int64_t target_sbc,
+ int64_t * msc, int64_t * sbc );
+ /**
+ * Wait for the MSC to equal target_msc, or, if that has already passed,
+ * the next time (MSC % divisor) is equal to remainder. If divisor is
+ * zero, the function will return as soon as MSC is greater than or equal
+ * to target_msc.
+ *
+ * \since Internal API version 20030317.
+ */
+ int (*waitForMSC)( __DRInativeDisplay * dpy, void *drawablePriv,
+ int64_t target_msc, int64_t divisor, int64_t remainder,
+ int64_t * msc, int64_t * sbc );
+ /**
+ * Like \c swapBuffers, but does NOT have an implicit \c glFlush. Once
+ * rendering is complete, waits until MSC is equal to target_msc, or
+ * if that has already passed, waits until (MSC % divisor) is equal
+ * to remainder. If divisor is zero, the swap will happen as soon as
+ * MSC is greater than or equal to target_msc.
+ *
+ * \since Internal API version 20030317.
+ */
+ int64_t (*swapBuffersMSC)(__DRInativeDisplay *dpy, void *drawablePrivate,
+ int64_t target_msc,
+ int64_t divisor, int64_t remainder);
+ /**
+ * Enable or disable frame usage tracking.
+ *
+ * \since Internal API version 20030317.
+ */
+ int (*frameTracking)(__DRInativeDisplay *dpy, void *drawablePrivate, GLboolean enable);
+ /**
+ * Retrieve frame usage information.
+ *
+ * \since Internal API version 20030317.
+ */
+ int (*queryFrameTracking)(__DRInativeDisplay *dpy, void *drawablePrivate,
+ int64_t * sbc, int64_t * missedFrames,
+ float * lastMissedUsage, float * usage );
+ /**
+ * Used by drivers that implement the GLX_SGI_swap_control or
+ * GLX_MESA_swap_control extension.
+ *
+ * \since Internal API version 20030317.
+ */
+ unsigned swap_interval;
+ /**
+ * Used by drivers that implement the GLX_MESA_copy_sub_buffer extension.
+ *
+ * \since Internal API version 20060314.
+ */
+ void (*copySubBuffer)(__DRInativeDisplay *dpy, void *drawablePrivate,
+ int x, int y, int w, int h);
diff --git a/include/GL/internal/glcore.h b/include/GL/internal/glcore.h
new file mode 100644
index 0000000..d5cbd3b
--- /dev/null
+++ b/include/GL/internal/glcore.h
@@ -0,0 +1,522 @@
+/* $XFree86: xc/lib/GL/include/GL/internal/glcore.h,v 1.7 2001/03/25 05:32:00 tsi Exp $ */
+#ifndef __gl_core_h_
+#define __gl_core_h_
+** License Applicability. Except to the extent portions of this file are
+** made subject to an alternative license as permitted in the SGI Free
+** Software License B, Version 1.1 (the "License"), the contents of this
+** file are subject only to the provisions of the License. You may not use
+** this file except in compliance with the License. You may obtain a copy
+** of the License at Silicon Graphics, Inc., attn: Legal Services, 1600
+** Amphitheatre Parkway, Mountain View, CA 94043-1351, or at:
+** Note that, as provided in the License, the Software is distributed on an
+** Original Code. The Original Code is: OpenGL Sample Implementation,
+** Version 1.2.1, released January 26, 2000, developed by Silicon Graphics,
+** Inc. The Original Code is Copyright (c) 1991-2000 Silicon Graphics, Inc.
+** Copyright in any portions created by third parties is as indicated
+** elsewhere herein. All Rights Reserved.
+** Additional Notice Provisions: The application programming interfaces
+** established by SGI in conjunction with the Original Code are The
+** OpenGL(R) Graphics System: A Specification (Version 1.2.1), released
+** April 1, 1999; The OpenGL(R) Graphics System Utility Library (Version
+** 1.3), released November 4, 1998; and OpenGL(R) Graphics with the X
+** Window System(R) (Version 1.3), released October 19, 1998. This software
+** was created using the OpenGL(R) version 1.2.1 Sample Implementation
+** published by SGI, but has not been independently verified as being
+** compliant with the OpenGL(R) version 1.2.1 Specification.
+#ifndef XFree86LOADER
+#include <sys/types.h>
+#ifdef CAPI
+#undef CAPI
+#define CAPI
+#define GL_CORE_SGI 1
+#define GL_CORE_MESA 2
+#define GL_CORE_APPLE 4
+typedef struct __GLcontextRec __GLcontext;
+typedef struct __GLinterfaceRec __GLinterface;
+** This file defines the interface between the GL core and the surrounding
+** "operating system" that supports it (currently the GLX or WGL extensions).
+** Members (data and function pointers) are documented as imported or
+** exported according to how they are used by the core rendering functions.
+** Imported members are initialized by the "operating system" and used by
+** the core functions. Exported members are initialized by the core functions
+** and used by the "operating system".
+ * Mode and limit information for a context. This information is
+ * kept around in the context so that values can be used during
+ * command execution, and for returning information about the
+ * context to the application.
+ *
+ * Instances of this structure are shared by the driver and the loader. To
+ * maintain binary compatability, new fields \b must be added only to the
+ * end of the structure.
+ *
+ * \sa _gl_context_modes_create
+ */
+typedef struct __GLcontextModesRec {
+ struct __GLcontextModesRec * next;
+ GLboolean rgbMode;
+ GLboolean floatMode;
+ GLboolean colorIndexMode;
+ GLuint doubleBufferMode;
+ GLuint stereoMode;
+ GLboolean haveAccumBuffer;
+ GLboolean haveDepthBuffer;
+ GLboolean haveStencilBuffer;
+ GLint redBits, greenBits, blueBits, alphaBits; /* bits per comp */
+ GLuint redMask, greenMask, blueMask, alphaMask;
+ GLint rgbBits; /* total bits for rgb */
+ GLint indexBits; /* total bits for colorindex */
+ GLint accumRedBits, accumGreenBits, accumBlueBits, accumAlphaBits;
+ GLint depthBits;
+ GLint stencilBits;
+ GLint numAuxBuffers;
+ GLint level;
+ GLint pixmapMode;
+ /* GLX */
+ GLint visualID;
+ GLint visualType; /**< One of the GLX X visual types. (i.e.,
+ * \c GLX_TRUE_COLOR, etc.)
+ */
+ /* EXT_visual_rating / GLX 1.2 */
+ GLint visualRating;
+ /* EXT_visual_info / GLX 1.2 */
+ GLint transparentPixel;
+ /* colors are floats scaled to ints */
+ GLint transparentRed, transparentGreen, transparentBlue, transparentAlpha;
+ GLint transparentIndex;
+ /* ARB_multisample / SGIS_multisample */
+ GLint sampleBuffers;
+ GLint samples;
+ /* SGIX_fbconfig / GLX 1.3 */
+ GLint drawableType;
+ GLint renderType;
+ GLint xRenderable;
+ GLint fbconfigID;
+ /* SGIX_pbuffer / GLX 1.3 */
+ GLint maxPbufferWidth;
+ GLint maxPbufferHeight;
+ GLint maxPbufferPixels;
+ GLint optimalPbufferWidth; /* Only for SGIX_pbuffer. */
+ GLint optimalPbufferHeight; /* Only for SGIX_pbuffer. */
+ /* SGIX_visual_select_group */
+ GLint visualSelectGroup;
+ /* OML_swap_method */
+ GLint swapMethod;
+ GLint screen;
+ /* EXT_texture_from_pixmap */
+ GLint bindToTextureRgb;
+ GLint bindToTextureRgba;
+ GLint bindToMipmapTexture;
+ GLint bindToTextureTargets;
+ GLint yInverted;
+} __GLcontextModes;
+/* Several fields of __GLcontextModes can take these as values. Since
+ * GLX header files may not be available everywhere they need to be used,
+ * redefine them here.
+ */
+#define GLX_NONE 0x8000
+#define GLX_SLOW_CONFIG 0x8001
+#define GLX_TRUE_COLOR 0x8002
+#define GLX_DIRECT_COLOR 0x8003
+#define GLX_PSEUDO_COLOR 0x8004
+#define GLX_STATIC_COLOR 0x8005
+#define GLX_GRAY_SCALE 0x8006
+#define GLX_STATIC_GRAY 0x8007
+#define GLX_TRANSPARENT_RGB 0x8008
+#define GLX_SWAP_EXCHANGE_OML 0x8061
+#define GLX_SWAP_COPY_OML 0x8062
+#define GLX_SWAP_UNDEFINED_OML 0x8063
+#define GLX_RGBA_BIT 0x00000001
+#define GLX_COLOR_INDEX_BIT 0x00000002
+#define GLX_WINDOW_BIT 0x00000001
+#define GLX_PIXMAP_BIT 0x00000002
+#define GLX_PBUFFER_BIT 0x00000004